KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384783
Entry
101384783         CDS       T05148                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04915  Estrogen signaling pathway
oro05200  Pathways in cancer
oro05210  Colorectal cancer
oro05211  Renal cell carcinoma
oro05212  Pancreatic cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05223  Non-small cell lung cancer
oro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101384783 (TGFA)
   04012 ErbB signaling pathway
    101384783 (TGFA)
   04014 Ras signaling pathway
    101384783 (TGFA)
   04151 PI3K-Akt signaling pathway
    101384783 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101384783 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101384783 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101384783 (TGFA)
   05212 Pancreatic cancer
    101384783 (TGFA)
   05225 Hepatocellular carcinoma
    101384783 (TGFA)
   05214 Glioma
    101384783 (TGFA)
   05211 Renal cell carcinoma
    101384783 (TGFA)
   05215 Prostate cancer
    101384783 (TGFA)
   05223 Non-small cell lung cancer
    101384783 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101384783 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 101384783
NCBI-ProteinID: XP_004398708
UniProt: A0A2U3VTM9
LinkDB
Position
Unknown
AA seq 160 aa
MVPSAGQLALFALGLLLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVL
IHCCQVRKHCEWCQALVCRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtaccctcggctggacagctcgccttgttcgcgctgggtcttctgttggctgtgtgc
caggccctggagaacagcacatccgccctgagtgcagacccgcccgtggccgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaagacaagccagcatgtgtctgccattctgggtacgtgggcgcg
cgctgtgagcatgccgacctcctggccgtggtggccgccagccagaagaagcaggccatc
accgccctggtggtggtctccatcgtggccctggctgtcctcatcatcgcgtgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccaggctctggtctgccggcac
gagaagcccagtgccctgctgaagggaaggaccgcgtgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system