KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384959
Entry
101384959         CDS       T05148                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X2
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01523  Antifolate resistance
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04062  Chemokine signaling pathway
oro04064  NF-kappa B signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04380  Osteoclast differentiation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04623  Cytosolic DNA-sensing pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04668  TNF signaling pathway
oro04920  Adipocytokine signaling pathway
oro05132  Salmonella infection
oro05135  Yersinia infection
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05212  Pancreatic cancer
oro05215  Prostate cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05340  Primary immunodeficiency
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101384959 (IKBKG)
   04014 Ras signaling pathway
    101384959 (IKBKG)
   04064 NF-kappa B signaling pathway
    101384959 (IKBKG)
   04668 TNF signaling pathway
    101384959 (IKBKG)
   04151 PI3K-Akt signaling pathway
    101384959 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101384959 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101384959 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101384959 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101384959 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101384959 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101384959 (IKBKG)
   04660 T cell receptor signaling pathway
    101384959 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    101384959 (IKBKG)
   04659 Th17 cell differentiation
    101384959 (IKBKG)
   04657 IL-17 signaling pathway
    101384959 (IKBKG)
   04662 B cell receptor signaling pathway
    101384959 (IKBKG)
   04062 Chemokine signaling pathway
    101384959 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101384959 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101384959 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101384959 (IKBKG)
   05203 Viral carcinogenesis
    101384959 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101384959 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101384959 (IKBKG)
   05221 Acute myeloid leukemia
    101384959 (IKBKG)
   05220 Chronic myeloid leukemia
    101384959 (IKBKG)
   05215 Prostate cancer
    101384959 (IKBKG)
   05222 Small cell lung cancer
    101384959 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    101384959 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101384959 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101384959 (IKBKG)
   05135 Yersinia infection
    101384959 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101384959 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    101384959 (IKBKG)
   05162 Measles
    101384959 (IKBKG)
   05164 Influenza A
    101384959 (IKBKG)
   05161 Hepatitis B
    101384959 (IKBKG)
   05160 Hepatitis C
    101384959 (IKBKG)
   05168 Herpes simplex virus 1 infection
    101384959 (IKBKG)
   05163 Human cytomegalovirus infection
    101384959 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101384959 (IKBKG)
   05169 Epstein-Barr virus infection
    101384959 (IKBKG)
   05165 Human papillomavirus infection
    101384959 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101384959 (IKBKG)
   05142 Chagas disease
    101384959 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101384959 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101384959 (IKBKG)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101384959 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1 Filament
Other DBs
NCBI-GeneID: 101384959
NCBI-ProteinID: XP_004414571
UniProt: A0A2U3WY60
LinkDB
Position
Unknown
AA seq 412 aa
MSRPSWKSQPCEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQGTPESFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLNLEKLDLRRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESERETLQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSMGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADI
YKADFQAERQAREQLAEKKEFLQEQLEQLQREYSRLKASCQESARIEDLRKRHVEVSQAP
LPPTPAHPSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcaggccctcctggaagagtcagccgtgtgagatggtgcagcccagtggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccggctatgctccac
ctgccttctgagcagggtactccggagagcttccaacgctgtctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgcgaggagctacag
cgtttccagggcagccagaggaaggagaaggagttcctcatgcagaagttccaggaagcc
aggaaactggtagagagactgaacctggagaagctcgacctgaggaggcagagggagcag
gccctgcaggaggtggaacatctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacatccttgctgggggagctccaagagagccagagtcgtttg
gaggccgccaccaaggagcggcaggctttggagggcagggcccgggctgctagcgagcag
gcccggcagctggagagcgagcgggagacgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggcggccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaagag
tatgacaaccacatcaagagcagcatgggaatgcagctggaggatctcaagcagcagctc
cagcaggccgaggaggccctggtggccaaacaggaagtgattgacaagctgaaggaagag
gccgagcagcacaagattgtgatggagactgtcccggtgctgaaggctcaggcggatatc
tacaaggccgacttccaggccgagaggcaggcccgggaacaactggcggagaagaaggag
ttcctgcaggagcagctggagcagctgcagagggaatacagcaggctgaaggccagctgt
caggagtcggccaggattgaagatctgaggaagcggcacgtggaggtctcccaggccccc
ttaccccccaccccagctcacccctcctttcacctggccctgcccagccagaggagaagc
ccccccgaggagccgcctgacttctgttgccccaagtgccagtatcaggctcctgatatg
gacaccctgcagatacatgtcatggagtgcatcgagtag

DBGET integrated database retrieval system