KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385380Help
Entry
101385380         CDS       T05148                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00052  Galactose metabolism
oro00500  Starch and sucrose metabolism
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101385380 (GANC)
   00500 Starch and sucrose metabolism
    101385380 (GANC)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101385380 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 101385380
NCBI-ProteinID: XP_004400449
UniProt: A0A2U3VXZ8
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MEAAGKEEISVEDEAVDKNIFKDCSKIAFYRRQKQQLSRRATYQASLDSATIGKDSTKFQ
IISETTKVSLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPSTVRLISCSGDADS
LVLTDGKGDLKCNITANPFKIDLVSEEEVVMSINSLGQLYFEHLQIPLKQRAAKENKEDT
SVDASQEDQEDLGLWEEKFGKFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
SDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEINTEPAV
KYTLTQMGPVAAKQKFRCRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDIKQVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKNRKLVVISDPHIKIDPNYSVYVKAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTNPKVREWYSGLFTFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EYTRLIREAIRQRYTLLPYWYSLFYRAHVAAQPVMRPLWIEFPEELDTFGVEDEYMLGSA
LLVHPVTEPKASTVDVFLPGSNEVWYDCKTFAHWEGARTVKILVALDTIPVFQRGGSIVP
IKTTVGKSTGYMTDSPYGLRVALSTKDSAMGEFYLDDGHSFRYLHQKQFLHRKFSFLSDV
LINSCADERGHYPSKCVVEQIFVLGLKKQPSSVTTCSSDGKDEPVAFTYCAQMSTLRLEK
LSLNISADWEVHIR
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctgggaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagattgcagcaagattgctttctacaggcgtcagaaacagcagctctccagaaga
gccacctatcaggcatcactagactcagccacaataggcaaagacagcaccaagttccaa
atcatcagtgaaacaaccaaggtttctcttctggctgaagtttatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaactcccctgaaacccaggtatgaagttcccgat
gtcctcacaagcaagcccagcactgtaaggctgatttcatgttcaggggatgcagatagt
ctggtattgacagatggaaaaggagatctgaagtgtaatatcacagcaaaccctttcaaa
atagatttggtgtctgaagaagaggtggtgatgagcataaactccctgggccagttgtac
ttcgagcatctgcagattcctctcaagcaaagagctgccaaagaaaataaggaggacaca
tcagttgatgcttctcaggaagaccaagaggatctgggcctgtgggaggagaaattcgga
aaatttgtggatgtcaaagttaatggtcctgcctccattggtttggatttctccttgcat
ggatttgagcatctctacgggatcccgcaacatgcagaatcacaccaacttaaaaatacg
agtgatggcgatgcttaccgtctttataacctggatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccataaactcggcaggactcta
ggcattttttggctcaatgcctccgaaacactggtggagatcaatacagagcctgcagta
aagtacacactgacccagatgggccctgttgcagctaaacaaaagttcagatgtcgaact
gatgtgcactggatgtcagagagtggaatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcaagcagtactcataccttacaggcacacaagccatgccccctctc
ttctccttggggtaccatcagtgccgctggaactatgaggatgagcaggacataaaacag
gtggatgcaggatttgatgaacatgacattccttatgatgtcatgtggcttgacatagag
cataccgagggcaaaaggtacttcacttgggacaagaaaagattcccaaaccccaaaagg
atgcaagagctgctcagaagcaaaaaccgtaagcttgtggtcatcagtgacccccacatc
aagatcgatcctaactactcagtgtatgttaaggccaaagaacagggcttctttgtgagg
aatcatgaaggaggagactttgaaggggtatgctggcctggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattccggtcttttcactttctctgcttatcag
ggatctactgacatcctctacatatggaacgacatgaatgagccctctgtctttagaggg
ccagagctaaccatgcagaagaatgccattcatcatggcaattgggagcacagggaactg
cacaacatctatggtttttatcagcaaatggctaccgcagaaggactgatacaacgatct
aaggggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgctgtgtggacgggtgacaacacagcagaatggagctacctgaaaatttctatcccc
atgttactcaccctcagcattactgggatctctttttgcggagctgatgtaggcggcttc
attgggaatccagaggcggagctgctagtgcgatggtaccaggctggagcctaccagccc
ttcttccgtggccacgctaccatgaacaccaagcggcgggaaccctggctctttggggag
gaatacacccggcttatccgggaagccatccggcagcgctacaccctcctgccctattgg
tattctctgttctaccgcgcacatgtggctgctcagcccgtcatgagacctctgtggata
gagttcccagaggaactagacacttttggtgtggaagatgaatatatgctgggaagtgct
ttattggttcatccagtcacagaaccaaaagccagcacagttgatgtgtttctgccagga
tcaaatgaggtctggtatgactgtaaaacatttgctcattgggaaggggcacgtactgtg
aagatcctggtagccttagacaccataccggtatttcagcgaggtgggagtatagtacca
ataaagacgactgtaggaaaatccacaggctacatgactgattccccatatggactccgg
gtggctctaagcactaaggattctgccatgggtgaattctatctcgacgatggccattca
ttccgatacctccaccagaagcagttcttgcacaggaagttttcattcttgtcagatgtt
ttgatcaacagttgtgccgacgaaagaggtcattatcccagcaagtgtgtggtggagcag
atctttgtcctaggcctcaagaagcagccatcttctgtgaccacctgttcatctgatggt
aaagatgagcctgtggcttttacatattgtgcccaaatgtccaccctgcgactggaaaag
ctgtccctgaacatcagcgctgactgggaggtccacatccgatga

DBGET integrated database retrieval system