KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385402
Entry
101385402         CDS       T05148                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro01524  Platinum drug resistance
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04115  p53 signaling pathway
oro04120  Ubiquitin mediated proteolysis
oro04144  Endocytosis
oro04151  PI3K-Akt signaling pathway
oro04218  Cellular senescence
oro04625  C-type lectin receptor signaling pathway
oro04919  Thyroid hormone signaling pathway
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101385402 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101385402 (MDM2)
   04151 PI3K-Akt signaling pathway
    101385402 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101385402 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    101385402 (MDM2)
   04115 p53 signaling pathway
    101385402 (MDM2)
   04218 Cellular senescence
    101385402 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101385402 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101385402 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101385402 (MDM2)
   05202 Transcriptional misregulation in cancer
    101385402 (MDM2)
   05206 MicroRNAs in cancer
    101385402 (MDM2)
   05205 Proteoglycans in cancer
    101385402 (MDM2)
   05203 Viral carcinogenesis
    101385402 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    101385402 (MDM2)
   05220 Chronic myeloid leukemia
    101385402 (MDM2)
   05218 Melanoma
    101385402 (MDM2)
   05219 Bladder cancer
    101385402 (MDM2)
   05215 Prostate cancer
    101385402 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101385402 (MDM2)
   05169 Epstein-Barr virus infection
    101385402 (MDM2)
   05165 Human papillomavirus infection
    101385402 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101385402 (MDM2)
   01522 Endocrine resistance
    101385402 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101385402 (MDM2)
   04121 Ubiquitin system [BR:oro04121]
    101385402 (MDM2)
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101385402 (MDM2)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101385402 (MDM2)
Ubiquitin system [BR:oro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101385402 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 101385402
NCBI-ProteinID: XP_004406037
UniProt: A0A2U3WC38
LinkDB
Position
Unknown
AA seq 487 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEPSDSGT
SVSENRCHLEGGSDQKDPVQELQEEKPSSSDLVSRPSTSSRRRAISETEEHSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEEKGKMPEKAKLENSTQVEEGFDVPDCKK
TAVNDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIYSSQEDVKEFEKEETQDKEE
IVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQM
IVLTYFP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagcctttgcttttgaagttgttaaagtct
gtcggtgcacaaaaagacacttatactatgaaagaggttatattttatcttggccaatat
attatgactaaacgattatacgatgagaagcaacagcatattgtgtattgttccaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcatgaaccatcagattcaggcaca
tctgtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggaccctgtgcaa
gagttgcaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagagcaattagtgagacagaagaacattcagatgaattacctggtgaacggcag
agaaagcgccacaaatctgatagtatttccctttcctttgatgaaagccttgctctgtgt
gtaatacgggagatatgttgtgaaagaagcagtagcagtgaatcaacagggacgccatca
aatccggatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattatagt
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagtaactgtg
tatcaggcaggggagagtgatacagattcgtttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcgtgcaatgaaatgaatcctcctcttccacctcattgcaac
agatgttgggcccttcgtgagaactggcttcctgaagaaaaagggaaaatgcctgagaaa
gccaaactagaaaactcaacacaagtagaagagggctttgatgtccctgattgtaaaaaa
actgcagtgaatgattccagagaatcatgtgctgaggaaaatgatgataaaatcacacaa
gcctcccaatcccaagaaagtgaggactattctcagccatcaacttctaacagcatcatt
tatagcagccaagaagatgtcaaagagtttgagaaggaagaaacacaagacaaagaagaa
attgtggaatctagttttccccttaatgccattgaaccttgtgtgatttgccaaggtcgg
cctaaaaatggttgcattgttcatggcaaaacaggacatcttatggcatgctttacatgt
gcaaagaagctaaagaaaaggaataagccctgtccagtatgtagacaaccaattcaaatg
attgtgctaacttatttcccctag

DBGET integrated database retrieval system