KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385858
Entry
101385858         CDS       T05148                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04151  PI3K-Akt signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro04657  IL-17 signaling pathway
oro05144  Malaria
oro05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101385858 (CSF3)
   04151 PI3K-Akt signaling pathway
    101385858 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101385858 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101385858 (CSF3)
   04657 IL-17 signaling pathway
    101385858 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101385858 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    101385858 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101385858 (CSF3)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  CSF and other factors
   101385858 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6 Sigma54_AID EKR
Other DBs
NCBI-GeneID: 101385858
NCBI-ProteinID: XP_004395089
UniProt: A0A2U3VJM2
LinkDB
Position
Unknown
AA seq 195 aa
MKLTALQLLLWHSALWLVQEATPLRPTSSLPQSFLLKCLEQMRKVQADGTVLQERLCATH
KLCHPEELVLLGHALGIPQPPLSSCSSQALQLTGCLHQLHSGLVLYQGLLQALAGITPEL
APTLDMLQLDISDFAFNIWQQMEELGLAQAVPPSQGTMPTFTSAFERRAGGVLVASSLQS
FLELAYRALRCFAKP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgacggcccttcagctgctgctgtggcacagcgcactctggctagtgcaagaa
gccacccccctgcgcccgaccagctcgctgccccagagcttcctgctcaagtgcttggag
caaatgcggaaggtccaggctgatggcacagtgctgcaggagaggctgtgcgccacccac
aagctgtgccaccccgaggagctggtgctgctcggacacgctctgggcatcccccagcct
cccctgagcagctgctccagccaggccctgcagctgacgggctgcctgcatcaactccac
agcggccttgtcctctaccagggcctcctgcaggctctggcagggataacccccgagtta
gcccccaccttggacatgctgcagctggacatcagcgactttgctttcaatatctggcag
cagatggaagagctggggctggcccaggcagtgccgcccagccagggcaccatgccaacc
ttcacctcggccttcgagcgccgggccggaggggtcctggtggcctccagcctgcagagc
ttcctggagctggcctaccgcgctctgcgctgctttgccaaaccctga

DBGET integrated database retrieval system