KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385969
Entry
101385969         CDS       T05148                                 

Gene name
CD3D
Definition
(RefSeq) T-cell surface glycoprotein CD3 delta chain
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro05142  Chagas disease
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101385969 (CD3D)
   04660 T cell receptor signaling pathway
    101385969 (CD3D)
   04658 Th1 and Th2 cell differentiation
    101385969 (CD3D)
   04659 Th17 cell differentiation
    101385969 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101385969 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    101385969 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101385969 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    101385969 (CD3D)
   05162 Measles
    101385969 (CD3D)
   05169 Epstein-Barr virus infection
    101385969 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101385969 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101385969 (CD3D)
CD molecules [BR:oro04090]
 Proteins
  101385969 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5 DAP10
Other DBs
NCBI-GeneID: 101385969
NCBI-ProteinID: XP_004415109
UniProt: A0A2U3WZT9
LinkDB
Position
Unknown
AA seq 171 aa
MEHCRFLAGLILAVLLSQVSPYKIIVEELEDKVFLNCNTSIILLEGKMGTPFPHDKIWDL
GKRILDPRGMYKCKGTDEQDDKIPYMQVYYRMCQNCVELDSATLAGIVITDIIATLLLAL
GVYCFAGHETGRLSKAADSQVLLENDQLYQPLRDRNDAQYSHLGENWPRKK
NT seq 516 nt   +upstreamnt  +downstreamnt
atggaacactgtaggtttctggctggcctgatactggctgtccttctctcccaagtgagc
ccctacaagataatcgtggaggaacttgaggacaaggtgttcctgaattgcaataccagc
atcattctgttagagggaaagatgggaacaccattcccacacgataaaatttgggacttg
ggaaaacgcatcctggacccacgaggaatgtataagtgcaaggggacagatgaacaagac
gacaaaataccttatatgcaagtatattatcgaatgtgtcagaactgtgtggagctggac
tcagccaccctggctggtatcgtcatcactgacataatcgccactctgctccttgctttg
ggagtttattgctttgctggacatgagactggaagactctctaaggctgctgactctcaa
gttctgttggaaaatgaccagctctatcagccccttcgagatcggaatgatgctcagtac
agtcatcttggtgaaaactggcctcggaagaagtga

DBGET integrated database retrieval system