KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386060
Entry
101386060         CDS       T05148                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04020  Calcium signaling pathway
oro04066  HIF-1 signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04270  Vascular smooth muscle contraction
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04510  Focal adhesion
oro04540  Gap junction
oro04613  Neutrophil extracellular trap formation
oro04650  Natural killer cell mediated cytotoxicity
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04670  Leukocyte transendothelial migration
oro04713  Circadian entrainment
oro04720  Long-term potentiation
oro04723  Retrograde endocannabinoid signaling
oro04724  Glutamatergic synapse
oro04725  Cholinergic synapse
oro04726  Serotonergic synapse
oro04727  GABAergic synapse
oro04728  Dopaminergic synapse
oro04730  Long-term depression
oro04750  Inflammatory mediator regulation of TRP channels
oro04911  Insulin secretion
oro04912  GnRH signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04919  Thyroid hormone signaling pathway
oro04921  Oxytocin signaling pathway
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04928  Parathyroid hormone synthesis, secretion and action
oro04929  GnRH secretion
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro04960  Aldosterone-regulated sodium reabsorption
oro04961  Endocrine and other factor-regulated calcium reabsorption
oro04970  Salivary secretion
oro04971  Gastric acid secretion
oro04972  Pancreatic secretion
oro05017  Spinocerebellar ataxia
oro05022  Pathways of neurodegeneration - multiple diseases
oro05031  Amphetamine addiction
oro05032  Morphine addiction
oro05143  African trypanosomiasis
oro05146  Amoebiasis
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05214  Glioma
oro05223  Non-small cell lung cancer
oro05225  Hepatocellular carcinoma
oro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101386060 (PRKCA)
   04012 ErbB signaling pathway
    101386060 (PRKCA)
   04014 Ras signaling pathway
    101386060 (PRKCA)
   04015 Rap1 signaling pathway
    101386060 (PRKCA)
   04310 Wnt signaling pathway
    101386060 (PRKCA)
   04370 VEGF signaling pathway
    101386060 (PRKCA)
   04066 HIF-1 signaling pathway
    101386060 (PRKCA)
   04020 Calcium signaling pathway
    101386060 (PRKCA)
   04070 Phosphatidylinositol signaling system
    101386060 (PRKCA)
   04072 Phospholipase D signaling pathway
    101386060 (PRKCA)
   04071 Sphingolipid signaling pathway
    101386060 (PRKCA)
   04151 PI3K-Akt signaling pathway
    101386060 (PRKCA)
   04150 mTOR signaling pathway
    101386060 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101386060 (PRKCA)
   04540 Gap junction
    101386060 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101386060 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    101386060 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    101386060 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    101386060 (PRKCA)
   04670 Leukocyte transendothelial migration
    101386060 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    101386060 (PRKCA)
   04929 GnRH secretion
    101386060 (PRKCA)
   04912 GnRH signaling pathway
    101386060 (PRKCA)
   04921 Oxytocin signaling pathway
    101386060 (PRKCA)
   04926 Relaxin signaling pathway
    101386060 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    101386060 (PRKCA)
   04918 Thyroid hormone synthesis
    101386060 (PRKCA)
   04919 Thyroid hormone signaling pathway
    101386060 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    101386060 (PRKCA)
   04916 Melanogenesis
    101386060 (PRKCA)
   04925 Aldosterone synthesis and secretion
    101386060 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101386060 (PRKCA)
   04270 Vascular smooth muscle contraction
    101386060 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    101386060 (PRKCA)
   04971 Gastric acid secretion
    101386060 (PRKCA)
   04972 Pancreatic secretion
    101386060 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101386060 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101386060 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101386060 (PRKCA)
   04727 GABAergic synapse
    101386060 (PRKCA)
   04725 Cholinergic synapse
    101386060 (PRKCA)
   04728 Dopaminergic synapse
    101386060 (PRKCA)
   04726 Serotonergic synapse
    101386060 (PRKCA)
   04720 Long-term potentiation
    101386060 (PRKCA)
   04730 Long-term depression
    101386060 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    101386060 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101386060 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    101386060 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101386060 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101386060 (PRKCA)
   05206 MicroRNAs in cancer
    101386060 (PRKCA)
   05205 Proteoglycans in cancer
    101386060 (PRKCA)
   05231 Choline metabolism in cancer
    101386060 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101386060 (PRKCA)
   05214 Glioma
    101386060 (PRKCA)
   05223 Non-small cell lung cancer
    101386060 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101386060 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    101386060 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    101386060 (PRKCA)
   05032 Morphine addiction
    101386060 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101386060 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101386060 (PRKCA)
   05161 Hepatitis B
    101386060 (PRKCA)
   05171 Coronavirus disease - COVID-19
    101386060 (PRKCA)
   05164 Influenza A
    101386060 (PRKCA)
   05163 Human cytomegalovirus infection
    101386060 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101386060 (PRKCA)
   05143 African trypanosomiasis
    101386060 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101386060 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101386060 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101386060 (PRKCA)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101386060 (PRKCA)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101386060 (PRKCA)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101386060 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 101386060
NCBI-ProteinID: XP_004415826
UniProt: A0A2U3X1C0
LinkDB
Position
Unknown
AA seq 671 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPEDRRPPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGT
EELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVN
GGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIAD
FGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRID
WEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNP
QFVHPILQSAV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgagacagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgtcactttttcttgtccgggtgcggataagggacccgacaccgatgaccccagaagc
aagcacaagtttaaaatccacacctatggaagccccaccttttgtgatcactgtgggtcc
ttgctgtatggacttatccatcaagggatgaaatgtgacacctgtgacatgaatgtgcac
aagcagtgtgtgataaatgtgcccagcctctgcgggatggaccacacggagaagcggggc
cggatctacctgaaggcggaggtcaccgatgagaagctccatgtcaccgtacgagatgca
aaaaatctaattcctatggatccaaatgggctttcagatccttatgtgaagctgaaactt
attcctgatccgaagaatgaaagcaaacagaaaaccaaaaccatccgctccacactaaac
ccccaatggaatgagtcctttacgttcaaattaaaaccttcagataaagaccgacggctg
tccgtagaaatctgggactgggatcgaacaacaaggaatgatttcatgggatccctttcc
tttggagtctcggagctgatgaagatgccggccagtggatggtacaagctgcttaaccaa
gaggaaggtgagtactacaacgtacccattccagaaggggatgaagaaggcaatgtggag
ctcaggcagaaattcgagaaagccaagcttggccctgctggtaacaaagtaatcagtcca
gaagacaggagaccaccttccaacaacctggacagagtgaaactcaccgacttcaatttc
ctcatggtgctggggaaagggagttttggaaaggtgatgcttgctgaccggaagggcacg
gaggaactgtatgctatcaaaatcctgaagaaggacgtggtgattcaagatgacgacgtg
gagtgcaccatggtggagaagcgagtcctagccctgttggacaagcccccgttcctgaca
cagctacactcctgctttcagacagtggaccggctgtatttcgtcatggaatacgtcaat
ggcggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaggcagta
ttttatgcagcagagatttccattggattgttctttcttcataaaagaggaatcatttac
agggatctgaagttagataatgtcatgctggattcggaagggcatatcaagattgccgat
tttgggatgtgcaaggaacacatgatggatggagtcacaaccaggaccttctgtgggacg
ccagattacattgccccagagataatcgcatatcagccgtatggaaaatccgtggactgg
tgggcctatggtgtcctattatatgaaatgctagccgggcagcctccctttgatggcgaa
gatgaagatgagctgtttcagtccataatggagcataacgtttcttatccgaaatccttg
tccaaggaggccgtttccatctgcaaaggactaatgaccaaacacccaggcaagcggctg
ggttgcgggccggagggggagagagacgtgcgggagcatgccttcttccgaaggatcgac
tgggagaagctggagaacagggagatccagccgcccttcaagcccaaagtgtgtggcaaa
ggcgcagaaaactttgacaagttcttcacgcgagggcagcctgtcttaacaccacctgat
cagctggtcattgctaacatagaccagtctgatttcgaggggttctcgtatgtcaatccc
cagtttgtgcaccccatcttacagagcgcagtatga

DBGET integrated database retrieval system