KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386196
Entry
101386196         CDS       T05148                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04151  PI3K-Akt signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04672  Intestinal immune network for IgA production
oro04940  Type I diabetes mellitus
oro05135  Yersinia infection
oro05142  Chagas disease
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05200  Pathways in cancer
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101386196 (IL2)
   04151 PI3K-Akt signaling pathway
    101386196 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101386196 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101386196 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101386196 (IL2)
   04660 T cell receptor signaling pathway
    101386196 (IL2)
   04658 Th1 and Th2 cell differentiation
    101386196 (IL2)
   04659 Th17 cell differentiation
    101386196 (IL2)
   04672 Intestinal immune network for IgA production
    101386196 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101386196 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101386196 (IL2)
   05321 Inflammatory bowel disease
    101386196 (IL2)
   05330 Allograft rejection
    101386196 (IL2)
   05332 Graft-versus-host disease
    101386196 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101386196 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101386196 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101386196 (IL2)
   05162 Measles
    101386196 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101386196 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101386196 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101386196 (IL2)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101386196 (IL2)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Haparin
  Cytokines
   101386196 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 101386196
NCBI-ProteinID: XP_004401636
UniProt: A0A2U3W0Y7
LinkDB
Position
Unknown
AA seq 155 aa
MYKMQLLSCIALTLVLVANSAPTTSSSTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM
LTFKFYTPKKATELTHLQCLAEELKLLEEVLYLAQSKNFHLTDIKELMSNINVTLLKLKG
SETSFKCEYDDETATITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtcttgcatcgcactgactcttgtactcgtcgcaaacagt
gcacctactacttcaagctctacaaaggaaacacagcaacagttggagcaattgctgctg
gatttacggttgctcttgaatggagttaataattatgagaaccctaaactctccaggatg
ctcacatttaaattctacacgcccaagaaggccacagaattgacacatcttcaatgtcta
gcagaagaactcaaacttctggaggaagtgctatatttagctcaaagcaaaaactttcac
ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga
tctgaaacaagtttcaaatgtgaatatgatgacgagacagcaaccattacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system