KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386198
Entry
101386198         CDS       T05148                                 

Gene name
IL25
Definition
(RefSeq) interleukin-25
  KO
K05493  interleukin 17E
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101386198 (IL25)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101386198 (IL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101386198 (IL25)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101386198 (IL25)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 101386198
NCBI-ProteinID: XP_004402216
UniProt: A0A2U3W2H0
LinkDB
Position
Unknown
AA seq 169 aa
MNQVIVFLVMAMGTHSLNFRIRKDCTHWPRCCPSKRQDPAHESLKGNTVLKLPREATSLT
HHPESCRASEDGPLNSRSISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPLG
NSELLYHNQTVFYRRPCPGEQGAHDGYCLEQKLYRVSLACVCVRPRVMA
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaaccaggtgatcgtgttcttggtaatggccatgggaacccacagcctcaattttcgg
atccggaaggactgcacccactggcccagatgctgccccagcaaaaggcaggaccccgct
cacgagtctctgaaggggaacactgtgctcaagctcccccgagaggccactagcctcacc
caccacccagaatcctgcagggccagtgaagacggacccctcaacagcaggtctatctct
ccctggagatatgagttggacagggacttgaaccggctcccccaggacctgtaccacgcc
cgctgcctgtgtccacactgtgtcagcctacagacgggctcccacatggaccccctgggc
aactcggagttgctctaccacaaccagaccgtcttctaccggcggccatgccctggcgag
cagggtgcccatgatggctactgcctggaacagaagctctaccgtgtctccttggcttgt
gtgtgtgtgcggccgcgagtgatggcctag

DBGET integrated database retrieval system