KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386367
Entry
101386367         CDS       T05148                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01522  Endocrine resistance
oro04110  Cell cycle
oro04218  Cellular senescence
oro04934  Cushing syndrome
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05212  Pancreatic cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05220  Chronic myeloid leukemia
oro05222  Small cell lung cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101386367 (RB1)
   04218 Cellular senescence
    101386367 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101386367 (RB1)
   05203 Viral carcinogenesis
    101386367 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101386367 (RB1)
   05225 Hepatocellular carcinoma
    101386367 (RB1)
   05226 Gastric cancer
    101386367 (RB1)
   05214 Glioma
    101386367 (RB1)
   05220 Chronic myeloid leukemia
    101386367 (RB1)
   05218 Melanoma
    101386367 (RB1)
   05219 Bladder cancer
    101386367 (RB1)
   05215 Prostate cancer
    101386367 (RB1)
   05224 Breast cancer
    101386367 (RB1)
   05222 Small cell lung cancer
    101386367 (RB1)
   05223 Non-small cell lung cancer
    101386367 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101386367 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101386367 (RB1)
   05161 Hepatitis B
    101386367 (RB1)
   05160 Hepatitis C
    101386367 (RB1)
   05163 Human cytomegalovirus infection
    101386367 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101386367 (RB1)
   05169 Epstein-Barr virus infection
    101386367 (RB1)
   05165 Human papillomavirus infection
    101386367 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101386367 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101386367 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101386367 (RB1)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101386367 (RB1)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    101386367 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 PsbQ
Other DBs
NCBI-GeneID: 101386367
NCBI-ProteinID: XP_004399546
UniProt: A0A2U3VVR2
LinkDB
Position
Unknown
AA seq 936 aa
MPPKTPRRAAAAAAAAAAAAAAAAAAAAEPPPPPPPPEEDPEQDSGPEDLPLPRLVFEET
EEPDFTALCQKLKIPDHVRERAWLTWEKISSVDGVLEGYVQRKKELWGICIFIAAVDLDE
MPFTFTELQKNIETSVCKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELI
YLTQPSSLISTEINSVLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPP
ALLKEPYKTAVIPFNGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVY
FKNFIPFMNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADPVDSFE
MQRTPRKSNTDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPK
ESILKRVKDVGYIFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQN
FSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVI
ESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLESACAL
NLSLQSNHTAADMYLSPVRSPKKKGSTIRVNSTANTEAQASSAFQTQKPLKSTSLSLFYK
KVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMKDRHLDQIMMCSMYGIC
KVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYA
STRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGVPTPTKMTPRSRIL
VSIGESFGTSEKFQKINQMVGNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEANGSKHLP
GESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNREEK
NT seq 2811 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagcagccgccgccgccgccgccgctgccgctgcc
gccgccgctgccgccgccgccgccgaacccccgccgccgccgccccctcctgaggaggac
cccgagcaggacagtggccccgaggacctgcctctgcccaggcttgtgtttgaagaaact
gaagaacctgattttactgcattatgtcagaaattaaagataccagatcatgtcagagaa
agagcttggttaacttgggagaaaatttcatctgtggatggagtattggaaggttatgtt
caaaggaaaaaggagctatggggaatctgtatctttattgcagcagttgacctagatgag
atgccattcacttttactgagctacagaaaaacatagaaaccagtgtctgcaaatttttt
gatttactgaaagaaattgataccagtaccaaagttgataatgctatgtcaagactgtta
aagaagtataatgtattgtgtgcactctacagcaaattagaaaggacatgtgaacttata
tatttgacacaacccagcagtttgatatctactgaaataaactctgtgttggtgctaaaa
gtttcttggatcacatttttactagctaaaggagaagtgttacaaatggaggatgatctc
gtcatctcatttcagttaatgctctgtgtccttgactattttattaaactctcacctcct
gcattgcttaaagaaccatataaaacagctgtaataccttttaatggttcacctcgaaca
ccaaggcgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgatacaaga
attattgaagttctctgtaaagaacatgaatgtaatatagatgaggtgaaaaatgtttat
ttcaaaaatttcataccttttatgaattctcttggaattgtagcttctaatggacttcca
gaggtggaaagtctctctaaacaatatgaagagatttaccttaaaaacaaagatcttgat
gcaagattatttctagatcatgataaaactcttcaggctgatcctgtagacagttttgaa
atgcagagaacaccacgaaaaagtaacactgatgaagaggtgaatgtgattcttccacag
actccagttcggactgttatgaatactatccaacaattaatgatgatcttaaattcagca
agtgatcaaccatcagaaaatctgatttcctattttaataactgcacagtgaatccaaag
gaaagtatcctgaaaagagtgaaggatgttggatacatctttaaagagaaatttgctaaa
gctgtgggacagggatgtatggaaattggatcacagcgatacaaacttggagtccgattg
tattaccgagtaatggaatccatgcttaaatcagaagaagaacgattatccattcaaaat
tttagcaaactcctgaatgacaacatctttcatatgtctttattggcatgcgctcttgag
gttgtaatggctacatatagcagaagtacatctcagaatcttgatactggaacagatttg
tccttcccatggattctgaatgtacttaatttaaaagcctttgatttttacaaagtgatt
gaaagttttatcaaagcagaagccaacttgaccagagaaatgataaaacatttagaacga
tgtgaacatcgaatcatggaatcacttgcatggctctctgattcacctttatttgatctg
attaagcaagcaaaagaccgagaaggaccagctgatcaccttgaatctgcttgtgctctc
aacctttctctccagagtaatcacactgcagcggatatgtatctctctcctgtaagatcc
ccaaagaaaaaaggatcaactatacgtgtaaattctactgcaaacacagaggcacaagca
agctcagccttccagactcagaagccattgaaatctacctctctttcacttttttacaag
aaagtgtaccgactagcatatcttcgactaaataccctgtgtgcacgccttctgtctgac
cacccagaactagaacacatcatctggaccctttttcagcacacactgcaaaatgagtat
gaactcatgaaagacaggcatttggatcagattatgatgtgttccatgtatggtatatgc
aaagtgaagaatatagaccttaaattcaaaatcattgtaacggcatacaaggatcttcct
catgctgttcaggagacattcaaacgtgttttgatcagagaagaggagtatgattccatt
atagtgttctataactcggtcttcatgcagagactgaaaacaaatattttgcagtatgct
tctaccaggccccctacgttgtcaccaatacctcacattcctcgaagcccttacaagttt
tctagttcacctttacggattcctggggggaacatttatatatcacccctgaagaatccg
tataaaatttcagaaggggtgccaacgccaacaaaaatgactccaagatcaagaatctta
gtatccattggtgaatcatttgggacttctgagaagttccagaaaataaatcagatggtg
ggtaacagcgaccgtgtgctcaaaagaagtgctgaaggcagcaaccctcctaaaccattg
aaaaaactacgctttgatattgaaggatcagatgaagcaaatggaagtaaacatctccca
ggggaatccaaatttcaacagaaactggcagaaatgacatctacccgaacacgaatgcag
aagcagaaaatgaacgatagcatggatacctcaaacagggaagaaaaatga

DBGET integrated database retrieval system