KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386487Help
Entry
101386487         CDS       T05148                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro03030  DNA replication
oro03410  Base excision repair
oro03420  Nucleotide excision repair
oro03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101386487 (LIG1)
   03410 Base excision repair
    101386487 (LIG1)
   03420 Nucleotide excision repair
    101386487 (LIG1)
   03430 Mismatch repair
    101386487 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oro03032]
    101386487 (LIG1)
   03400 DNA repair and recombination proteins [BR:oro03400]
    101386487 (LIG1)
Enzymes [BR:oro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101386487 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101386487 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101386487 (LIG1)
DNA replication proteins [BR:oro03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101386487 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101386487 (LIG1)
DNA repair and recombination proteins [BR:oro03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101386487 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101386487 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     101386487 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 101386487
NCBI-ProteinID: XP_004400969
UniProt: A0A2U3VZE2
LinkDB All DBs
Position
Unknown
AA seq 915 aa AA seqDB search
MQRSIMSFFYPKKEGKVKKPEKETSNSVRETEPPPKVALKERNGEVPESDSPVKRPGRKV
ARVLGSEGEEEDEALTPSKGQKPAPSSPQVSPPSPVTFPESSPSLSNTSPVDISPAGIPK
RRTARKQLPKRTVRDALEEQGKDESREAKRRKEEGAETPLESLTEPEVTQKKEAEGEGQP
MTPPEHAETSSEPPPDSILEPEVAGEQGAQEEDPAKPPARAPKTVSSFFAPRKPATKKEG
KEEGPGTARQEEAKGPLDPPSYNPAKNNYHPIDDACWKPGQKVPYLAVARTFEKIEEVSA
RLRMVETLSNLLRSVVTLSPPDLLPILYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGR
QLESVKAEAAEKGDVGLVAENSRSTQRLMLPPPALTAAGVFTKFRDIARLAGSASTAKKM
DVIKGLFVACRHSEARYIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQELPPAVVDAG
KGRTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGVPLKPML
AHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDIISR
IPKIKLPSVTSFILDTEAVAWDQEKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIY
LNGESLVREPLSRRRQLLRENFVPTEGEFVFATSLDTKDTEQIAEFLEQSVKDSCEGLMV
KTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYD
EESEELQAICKLGTGFSDEELEEHYQRLQALVLPTPRSYVRADGAVAPDHWLDPSAVWEV
KCADLSLSPIYPAARGLVDGEKGISLRFPRFIRVREDKKPEEATTSAQVASLYRKQSQIQ
NQQGADLDSDPEDFY
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagtattatgtcatttttctaccccaagaaggagggcaaagtgaaaaagcca
gagaaggagacctccaacagcgtcagagagacagagccacctccaaaggtggcactgaag
gagcgcaatggagaggtgcctgagagcgattctccagtgaagaggccagggcggaaggtg
gcccgggtcctgggcagtgaaggggaagaggaggacgaagccctcacgccctccaaaggc
cagaagcctgcccccagctctccacaagtctcccctcccagccctgtcacatttcccgag
agcagcccctccctctccaacacctctcctgtggacatctccccagcagggatcccaaag
cggcgcacagctcggaagcagcttcctaagcggacagtacgggatgccctggaggagcag
ggcaaggacgagagcagagaggccaagaggaggaaggaggaaggagctgagaccccactg
gaaagcctcacggagcctgaagtgacccaaaagaaagaagcggaaggggagggccagccc
atgacgccccctgagcacgcagagacctcctcagagcccccgccagacagcatcttggag
cctgaggtggcaggggagcagggggctcaagaggaggacccggccaagccgcccgccaga
gcgcccaagacggtcagcagcttcttcgccccccggaaaccggcaaccaagaaagaaggg
aaagaagagggacctggcacagcaagacaggaggaggccaagggacccctggaccccccc
agctacaatcctgccaagaacaactaccatcccatcgacgacgcatgctggaagccaggc
cagaaggtcccttacctagctgtggcccggacatttgagaagattgaggaagtttctgct
cggctccggatggtggagacgctgagcaacttgctgcgttccgtggtgaccctgtcacct
ccagacctcctccccatcctctacctcagcctcaaccgcctcgggccaccccaacagggc
ctggagcttggcgtcggtgacggcgtcctcctcaaggcggtggcccaggccacagggcgg
cagctggagtctgtcaaggccgaggcagctgagaagggcgacgtggggctggtggccgag
aacagccgcagcacccagagactcatgctgcccccacccgctctcactgccgccggggtc
ttcaccaagttccgagacatcgcccggctggccggcagtgcttccacagccaagaagatg
gacgtcatcaaaggcctctttgtcgcctgccgccactcagaagcccgatacatcgccaga
gccctgagcggacggctgcgcctcgggctggcagagcagtcggtgctggccgccctcgcc
caggccgtgagcctcacgcccccaggccaagaattgcccccggccgtcgtggatgctggg
aagggcaggacagcggaggcccgaaagacgtggctagaggagcaaggcatgatcctgaag
cagacgttctgcgaggtgcctgacctggaccggatcatccctgtgctgctggagcacggc
ctggagcgcctcccggagcactgcaagctgagcccaggggttcccctgaaaccgatgctg
gcgcaccccacacgcggtgtcagcgaggtcctgaaacgctttgaggaggcagctttcacc
tgcgagtacaaatacgacgggcagagggcgcagatccacgtcctggaaggcggggaggtg
aagatcttcagcaggaatcaggaagacaataccggaaagtacccggacatcatcagccgc
atccccaagattaaactcccgtcagtcacatccttcatcctggacacggaagccgtggct
tgggaccaggaaaagaagcagatccagccattccaagtgcttaccacccgcaaacgcaag
gaggtggatgcggcagagatccaggtgcaggtgtgtctgtatgccttcgacctcatctac
ctcaatggagagtccctggtgcgtgagccgctttcccgacgccggcagcttctccgggag
aacttcgtgccgacggagggcgagtttgtcttcgccacctccctggacaccaaggacacg
gagcagatcgccgagttcctggagcagtctgtgaaagactcctgcgaggggctgatggtg
aaaaccctggacgtcgatgccacctacgagatcgccaagagatcccacaactggctgaag
ctgaagaaggactaccttgatggtgtgggcgacaccctggacctcgtggtgatcggcgcc
tacctgggccgtggcaagcgggccggccgctatgggggcttcctgctggctgcctacgac
gaggagagtgaggagctccaggccatatgcaagctcggaactggcttcagtgacgaggag
ctggaggagcattaccagaggctccaggccctggtgctgcccaccccacgctcctacgtc
cgggcggacggcgccgtggcccctgaccactggctggaccccagtgccgtgtgggaggtg
aaatgtgccgatctgtccctgtcccccatctaccccgctgcccggggcctggtggatggt
gagaaggggatctcccttcgcttccctcggtttatccgcgtccgtgaagacaagaagccc
gaggaggccaccaccagtgcccaggtggcctccctgtacaggaagcagagtcagattcag
aaccagcagggcgcggacttggactccgacccagaagatttctactag

DBGET integrated database retrieval system