KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386503Help
Entry
101386503         CDS       T05148                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00052  Galactose metabolism
oro00500  Starch and sucrose metabolism
oro01100  Metabolic pathways
oro04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101386503 (GAA)
   00500 Starch and sucrose metabolism
    101386503 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101386503 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101386503 (GAA)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101386503 (GAA)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101386503 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101386503
NCBI-ProteinID: XP_012419241
UniProt: A0A2U3ZKV2
LinkDB All DBs
Position
Unknown
AA seq 964 aa AA seqDB search
MDVRWPPSSRPLLGVCTFVSLASAAFLGHVLLRDFLVVPQEQRGFSQVPEELYRARQQGS
SDPGPQPTPGHHGSPRAAPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYRPARQWPQVP
RMGQPWCFFPPSYPSYKLENLTTTETGYTATLTRNTPTFFPKDILTLRLDVLLETESRLH
FTIKDPANRRYEVPLETPRVRSRASSTLYSMEFQEEPFGVVVHRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQHITGLAEHLGSLMLSTNWTKITLWNRDIAPSPNVNLYGSHPFYLV
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDMYIFLGPEPKSVVQQYLEVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRARFPLDTQWNDLDYMDARRDFTFNKDG
FRDFPAMVQDLHQDGRRYVMIVDPAISSSSPPGSYRPYDEGLRRRVFITNETGQPLIGKV
WPGFTAFPDFTSPEALDWWQDMVSEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDNDLEN
PPYVPGVVGGTLRAATICASSRQFLSTHYNLHNVYGLTEALASHRALVRARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNDLKSLPQEPYRFSETAQEAMRKALSLRYALLPYLYLLFHRAHVLG
ETVARPLFLEFPEDPRTWTVDQQLLWGAAVLITPVLEAGKVQVTGYFPSGTWYNLQTVPG
EAFGSLPPPPRAPLTSAIHSKGQWVTLPAPLDTINLHLRAGHIIPLQGPGLTTTESRKQP
MALLAALTTNREAQGELFWDDGESLGVPERGDYTKVIFLARNNTIVNELVHVTSEGASLQ
LRKVTILGVAVAPSQVLSNGVPVSNFTYSPDTKARGPIDGARGLVHQDGRGGGRCQGPWG
PGIS
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgaggtggcctcccagctcccgccccctgctgggggtctgcacctttgtctcc
ctggccagcgctgccttcctggggcacgtcctgctccgagatttcttggtggtcccccaa
gagcagcgtggcttctcccaagtacctgaggagctttatcgtgctcgccagcagggatcc
agtgacccaggcccccagcccaccccagggcaccacggcagtccccgagcagcacccaca
cagtgcgatgtgccccccaacagccgcttcgactgtgcccccgacaaggccatcacccag
gagcagtgtgaggcccggggctgttgctaccggcctgcaaggcagtggcctcaggtcccc
cggatggggcagccctggtgcttcttcccacccagctacccgagttacaagctggagaac
ctgaccaccacagagacaggctacacggccaccctgacccgcaacaccccaaccttcttc
cccaaggacatcttgaccttacggctggacgtgctgctggagacggagagccggcttcac
ttcacgatcaaggatcccgccaacaggcgctacgaggtgcccctggagactccacgtgtc
cgcagccgggcctcgtccacactctacagcatggagttccaggaagagccttttggggtg
gtcgtgcaccggaagctggatggccgggtgctgctgaacacgacggtggcccccctgttc
ttcgccgaccagtttctgcagctgtccacctccctgccgtcccagcacatcacgggcctt
gccgagcatctcggctccctgatgctcagcaccaactggaccaagatcaccctctggaac
cgggacatcgccccctcgcccaacgtgaacctgtatgggtcgcatcctttctacctggtg
ctggaggatggcgggtcagctcacggggtcttcctgctgaacagcaatgccatggatgtg
gtcctgcagccgagcccggccctcagctggaggtcgacaggtgggatcctggacatgtac
atcttcctaggccctgagcccaagagcgtggtgcagcagtacctggaagtcgtgggctac
ccgttcatgccgccgtactggggcctgggcttccacctctgccgctggggctactcctcc
accgccatcacccgccaggtggtagagaacatgaccagggcccgcttccccctggacacg
cagtggaatgacctggactacatggacgccaggagggacttcaccttcaacaaggacggt
ttcagggacttcccggccatggtgcaggatctccaccaggatggccggcggtacgtgatg
atcgtggaccctgccatcagcagctccagcccccccggcagctaccgtccctatgacgag
ggtctgcggaggagggttttcatcaccaacgagaccgggcaacctctgattgggaaggtg
tggcccggattcaccgccttccccgacttcaccagccccgaggccctggactggtggcag
gacatggtgtctgagttccacgcccaggtgcccttcgacggcatgtggatcgacatgaac
gagccctccaacttcgtaaagggctctgtggatggctgccccgacaacgacctggagaac
ccgccctacgtgccaggggtggttggcgggaccctgcgggccgccaccatctgtgcctcc
agccgccagttcctctccacgcactacaacctgcacaacgtgtacggcctgacggaagcc
ctcgcctcccacagggccctcgtgagggctcgggggacgcgcccctttgtgatctcccgc
tcaaccttcgccggccacggccgatacgccggccactggacgggggatgtgtggagcagc
tgggagcagctgtcgtactccgtgccagaaatcctgctgttcaacctgctgggggtgcca
ctggtcggggccgacgtctgtggcttcctgggcaacacctcggaggaactgtgtgtccgc
tggacccagctgggggccttctacccgttcatgcggaatcacaacgacctcaaaagcctg
cctcaggagccgtacaggttcagcgagaccgcgcaggaagccatgcggaaggccctcagc
ctgcgctacgccttgctgccctacctgtacctgctgttccaccgggcccacgtcctgggc
gagaccgtggcccggcccctcttcctggagttccccgaggacccccgcacctggaccgtg
gaccagcagctcctgtggggggcagctgtgctcatcacccccgtgcttgaggctgggaag
gtccaagtgactggctacttcccttctggcacatggtacaacctgcagacagtgccagga
gaggccttcggcagcctcccacctccacctcgggctcccctcacgtctgccatccacagc
aaggggcagtgggtgaccctgccggccccactggacaccatcaacctccacctccgggct
ggacacatcatccccctgcagggccctggcctcacaaccacggagtcccggaagcagccc
atggccctgctcgcagccctgaccacaaacagggaggcccaaggggagctattctgggat
gacggggagagcctgggggtgccagagcgcggggactacacgaaggtcatcttcctggcc
aggaataacaccatcgtgaacgagctggtgcacgtgactagcgagggcgccagcctgcag
ctgaggaaggtgaccatcctgggggtggccgtggcccccagccaggtcctctctaatggc
gtccctgtctccaacttcacctacagccctgacaccaaggcaagagggcccatagatggg
gccagagggcttgtccaccaggatggccgagggggcgggaggtgccaaggaccctgggga
cctggtatcagctga

DBGET integrated database retrieval system