KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386986
Entry
101386986         CDS       T05148                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101386986 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101386986 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101386986 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101386986 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101386986 (IL11)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101386986 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 101386986
NCBI-ProteinID: XP_004405095
UniProt: A0A2U3W9T7
LinkDB
Position
Unknown
AA seq 199 aa
MNSVCCLVLVALSLWPDRAAAPGPPPGPPRASPDPRAELDSAVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLFSYLRHVQWLRRAGGPSLR
TLEPELGALQARLDRLLRRLQLLMSRLALPQAPPDPPAPPLAPPASAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaacagtgtttgctgcctggtcctggtcgccctgagcctgtggccagatagagctgct
gccccagggccacctcctggccccccgcgggcctccccagaccctcgggctgagctggac
agcgccgtcctcctgacccgctccctcctggcggacactcggcagctggcggcacagctg
agagacaaatttccagccgacggagaccacaacctggactctcttcccaccttggccatg
agtgcaggggcgctgggagccctacaactcccaggtgtgctgacacggctgcgagccgac
ctgttctcctacctgcgccatgtgcagtggctgcgccgagccgggggcccttccctgcgg
accctggagccggagctgggtgccctgcaggcccggctggaccgcctgcttcgccggctg
cagctcctgatgtcccgcctggccttaccccaagcacccccagacccaccagctcccccg
ctggctcccccggcctctgcctggggaggcatcagggcagcccacgccattcttgggggg
ttgcacctgacccttgactgggccgtgcggggcttgctactgctgaagactcggctgtga

DBGET integrated database retrieval system