KEGG   Odobenus rosmarus divergens (Pacific walrus): 101387008Help
Entry
101387008         CDS       T05148                                 

Gene name
PFKL
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, liver type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00010  Glycolysis / Gluconeogenesis
oro00030  Pentose phosphate pathway
oro00051  Fructose and mannose metabolism
oro00052  Galactose metabolism
oro01100  Metabolic pathways
oro01200  Carbon metabolism
oro01230  Biosynthesis of amino acids
oro03018  RNA degradation
oro04152  AMPK signaling pathway
oro05230  Central carbon metabolism in cancer
Module
oro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101387008 (PFKL)
   00030 Pentose phosphate pathway
    101387008 (PFKL)
   00051 Fructose and mannose metabolism
    101387008 (PFKL)
   00052 Galactose metabolism
    101387008 (PFKL)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101387008 (PFKL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101387008 (PFKL)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101387008 (PFKL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101387008 (PFKL)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oro03019]
    101387008 (PFKL)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101387008 (PFKL)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101387008 (PFKL)
Messenger RNA biogenesis [BR:oro03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101387008 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101387008
NCBI-ProteinID: XP_004410714
UniProt: A0A2U3WNP6
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVGAGKISESTARTYSHLSIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NLMCERLGETRSTGSRLNIIIIAEGAIDRNGKPISSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTQACVVSLSGNQSVRLPLMECVQVTKEVQK
AMDEKRFDEAIQLRGRSFENNWNIYKLLAHQKLSKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKGQVQEVSWHDVAGWLGRGGSMLGTKRTLPKSYMEKI
VENIRTHNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IQDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRAVYRNGRVFANAPDSACVIGLQKKAVAFS
PVTELKKDTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRSLSIDKGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgtggacctggagaagctgcgaatgtccggggccggcaaggccatcggcgtg
ctgaccagcggcggagatgcgcaaggtatgaacgcggctgtcagagctgtgacgcgcatg
ggcatttacgtgggagccaaagttttcctcatctacgagggttacgagggcctcgtggaa
ggaggcgagaacatcaagcaggccaactggctcagtgtctccaacatcatccagctgggc
ggaaccatcatcggcagcgcccgctgcaaggccttcaccactcgggagggacgcctggcg
gcggcctacaacctcgtgcagcgtggcatcaccaacctgtgtgtcatcggcggggacggc
agcctcacgggcgccaacatcttccgcagcgagtggggcagcctgttggaggagctggtg
ggggcaggcaagatctcggagagcacggcgcggacgtactcgcacctgagcatcgcgggc
ctggtgggttccatcgacaatgacttctgtggcaccgacatgaccatcggcaccgactcg
gccctgcaccgcatcatggaggtcattgacgccatcaccaccaccgcccagagccaccag
aggacctttgtgctggaggtgatgggacggcactgcgggtacctggccctggtgtccgcc
ctggcctcgggggccgactggctgttcatccctgaggcaccccccgaggatggctgggag
aacttaatgtgtgagaggctgggtgagactcggagcacggggtcccgactgaacatcatc
atcattgccgagggcgccattgaccgcaatgggaagcccatctcctcccgctacgtgaag
gacctggtggtccagaggctgggcttcgacacacgtgtgactgtgctgggccacgtgcag
aggggagggaccccttcagcgttcgaccgcatcctgagcagcaagatgggcatggaggcg
gtcatggcactgctggaggccacaccggacacacaggcctgcgtggtcagcctctcgggg
aaccagtcggtgcggctgcccctcatggagtgtgtgcaggtgacaaaggaggtgcagaag
gccatggatgagaagaggtttgacgaggccatccagctccgcggcaggagctttgagaac
aactggaacatttacaagctgcttgcacaccagaagctctccaaagagaagaccaacttc
tccctggccatcctgaacgtgggcgccccggcggctggcatgaacgcggcggtgcgctcg
gccgtgcggtccggcatctcccagggccacacggtgtatgtcgtgcacgatggcttcgaa
ggcctggccaagggtcaggtacaagaagtgagttggcatgacgtggccggctggctgggc
cgtggcggctccatgctgggaaccaagaggacgctgcccaagagctacatggagaagata
gtggaaaacatccgtacccacaacatccacgccctgctggtcatcggtggctttgaggcc
tacgagggggtgctgcagttggtggaggcgcgcgggcgctacgaggaactctgcatcgtc
atgtgcgtcatcccggccaccatcagcaacaacgtaccaggcaccgacttcagcctgggc
tcggacaccgctgtcaacgccgccatggagagctgtgaccgtatcaagcagtcggcttcg
gggaccaagcgccgcgtgttcatcgtggagaccatggggggctactgcggctacctggcc
acggtgacgggcatcgcggtgggcgccgatgccgcctacgtcttcgaggaccctttcaac
atccaagacttgaaagccaacgtggagcacatgacggagaagatgaagacggacatccag
aggggcctggtgctccgaaatgagaagtgccacgaacactacaccacggagtttctgtac
aacctgtactcctccgaggggaagggcgtgtttgactgtaggaccaacgtcctgggccac
ctgcagcagggtggtgccccgaccccctttgatcggaactacgggaccaagctcggggtg
aaggccatgctctggatgtcggagaagctgcgggcggtctaccgcaatggacgagtgttt
gccaacgctcctgactcggcctgtgtgatcggcctacagaagaaggcagtggccttcagc
cccgtcaccgagctcaagaaggacacggactttgaacaccgcatgccccgggagcagtgg
tggctgaacctgcggctcatgctgaagatgctggcgcattaccgcatcagcatggccgac
tacgtgtccggggagctggagcacgtcacccgccgcagcctcagcatcgacaagggcttc
tga

DBGET integrated database retrieval system