KEGG   Ornithinimicrobium sp. H23M54: FNH13_11155Help
Entry
FNH13_11155       CDS       T06094                                 

Gene name
fabI
Definition
(GenBank) enoyl-ACP reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
orz  Ornithinimicrobium sp. H23M54
Pathway
orz00061  Fatty acid biosynthesis
orz00780  Biotin metabolism
orz01100  Metabolic pathways
orz01130  Biosynthesis of antibiotics
orz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:orz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FNH13_11155 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FNH13_11155 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FNH13_11155 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:orz01004]
    FNH13_11155 (fabI)
Enzymes [BR:orz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FNH13_11155 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FNH13_11155 (fabI)
Lipid biosynthesis proteins [BR:orz01004]
 Fatty acid synthase
  Component type
   FNH13_11155 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: QDO88812
LinkDB All DBs
Position
complement(2427556..2428311)
Genome map
AA seq 251 aa AA seqDB search
MLLDGKKLLVTGVLMDSSIAFHVARLAQEQGAEVVLTSFGRTFRITQSIAKRLPVTPEVV
ELDVSNQEHLDTLAERLREHTDHLDGVLHSIGFAPRGAFDFMNAPWEDVATALQVSAYSL
KSLAVAALPLMSEGGSIVGLTMDAQVAWPVYDWMGVAKAAFEATNRYLARDLGAQGIRSN
LVAAGPIATTAARSIPMFEQFAKWGERAPLGWDLKDAEPAAKACVALLSDWFPATTGEIV
HVDGGFHAMGF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgacggaaagaagctccttgtcaccggggtcctgatggactcctccatcgcg
ttccatgttgctcgcctggcccaggagcagggtgccgaggtggtcctgacctccttcggt
cggaccttccggatcacccagtccatcgccaagcgtctgccggtcacccctgaggtggtc
gagctggacgtgtccaaccaggagcacctggacaccctggccgagcggttgcgcgagcac
accgaccacctggacggggtcctgcactcgatcgggttcgcacccaggggcgcgttcgac
ttcatgaacgcgccgtgggaggacgttgctacggcgctccaggtctcggcatactccctg
aagtccctggccgtggccgccctgccgctgatgagtgagggtggcagcatcgtgggcctg
accatggatgcccaagtcgcctggcccgtctatgactggatgggggtggccaaggccgcc
ttcgaggcgaccaaccgctatctggcccgcgacctgggcgcgcagggcatccggtccaac
ctcgtggcggccggcccgatcgccaccaccgcagcgcgttccatcccgatgttcgagcag
ttcgcgaagtggggcgagcgtgccccactggggtgggacctcaaggacgccgagcctgcc
gccaaggcctgcgtcgccctgctgtccgactggttcccggcgaccaccggtgagatcgtc
cacgtggacggcggcttccacgcgatgggtttctga

DBGET integrated database retrieval system