KEGG   Ornithinimicrobium sp. H23M54: FNH13_14145
Entry
FNH13_14145       CDS       T06094                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
orz  Ornithinimicrobium sp. H23M54
Pathway
orz00250  Alanine, aspartate and glutamate metabolism
orz00410  beta-Alanine metabolism
orz00640  Propanoate metabolism
orz00650  Butanoate metabolism
orz01100  Metabolic pathways
orz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:orz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FNH13_14145
   00650 Butanoate metabolism
    FNH13_14145
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FNH13_14145
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FNH13_14145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:orz01007]
    FNH13_14145
Enzymes [BR:orz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     FNH13_14145
Amino acid related enzymes [BR:orz01007]
 Aminotransferase (transaminase)
  Class III
   FNH13_14145
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: QDO89327
UniProt: A0A516GCU6
LinkDB
Position
3078645..3079904
AA seq 419 aa
MAELSPVLKQATPVVATRGEGVYLFDADDRRYLDFTAGIGVTSTGHCHPKVVAAAQEQVG
KLIHGQYTTVMHEPLLKLVDRLGEVLPEGLDRMFFANSGSEAIEAALRLARQATHRPNIV
VFHGGFHGRTVAAASLTTSGTKFRSGFAPLMAGVQVSPFPDPGHFGWPQEETTEFALRQL
DYTLQTLSSPEDTAAFLVEPVLGEGGYVPASTEFFAGLRERADKHGILLVVDEVQTGWGR
TGKFWGGDHFDARADIVVTAKGLASGFPLSGIAASHALMEKAWPGSQGGTYGANAVACAA
ALATLDVIQEEGLVENSATRGKQLKSALEDVAAQHPQITDVRGLGLMIANEFRDESGTPD
GKTAAAVQQEAAKRGLILLNNGAWGQCVRFIPALVVGEQDVVEAVGIWEESVAAVLSGA
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggccgagctttcgcctgttctgaagcaggctacgcctgtcgtcgccacccgcggcgag
ggtgtctacctgttcgacgcagacgatcgtcgctatctggacttcacggccggcatcggg
gtcaccagcaccggtcactgccaccccaaggtcgtcgcggccgcccaggagcaggtcggc
aagctgatccacgggcagtacacgacggtcatgcacgagccgctgctgaagctggtcgac
cgcctcggtgaggtgctgcccgaggggctggatcggatgttcttcgccaactccgggtcc
gaggcgatcgaggcggccctgcgcctggcccgacaggccacccaccggcccaatatcgtc
gtcttccacggcggatttcacggccgcaccgtggccgcggcctcgctgaccacctccggc
accaagttccgctccggcttcgctccgctgatggctggtgtgcaggtctcccccttcccg
gaccccggccacttcggctggccccaggaggagacgaccgagttcgccctgcgccagctg
gactacaccctgcagacgttgtcctcccccgaggacaccgctgccttcctggtggagccg
gtgctcggcgagggcggttatgtgccggccagcaccgagttcttcgctgggctgcgcgag
cgcgccgacaagcacgggatcctgctggtggtcgatgaggtgcagaccggctggggccgg
accggcaagttctggggcggcgaccacttcgacgcccgcgcggacatcgtggtcaccgcc
aagggtctcgcctccggcttcccgctctcgggcatcgccgcgtcccacgccttgatggag
aaggcatggcccggttcgcagggcggcacctatggcgcgaacgccgtggcctgcgccgca
gctctggccaccctggacgtcatccaggaggagggcctggtggagaacagcgcgacccgc
ggcaagcagctcaagtcggccctggaggacgtcgccgcccagcacccgcagatcaccgat
gtccgcggcctcgggctgatgatcgccaacgagttccgcgacgagagcggcacccccgac
ggcaagacggccgctgcggtccagcaggaggcggccaagcgcggcctcatcctgctcaac
aacggcgcctggggtcagtgcgtgcgcttcatccccgccctggtcgtcggcgagcaggac
gtcgtcgaggcggtcggcatctgggaggagtcggtcgccgcggttctcagcggcgcctga

DBGET integrated database retrieval system