KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107275630
Entry
107275630         CDS       T01015                                 
Name
(RefSeq) hexokinase-10
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107275630
   00051 Fructose and mannose metabolism
    107275630
   00052 Galactose metabolism
    107275630
   00500 Starch and sucrose metabolism
    107275630
   00520 Amino sugar and nucleotide sugar metabolism
    107275630
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107275630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    107275630
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107275630
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107275630
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 SpoIIE
Other DBs
NCBI-GeneID: 107275630
NCBI-ProteinID: XP_015638932
UniProt: Q2KNB5
LinkDB
Position
5:complement(18075010..18081327)
AA seq 504 aa
MEGRAAGWVRVAAVGWAVAACAVAAGMVARRGAARVRWNRAVAVVRDLEERCATPAELLQ
RVVNSLAIEMFAGLASDGGSKVRMLLTCVDALPDGSEEGISYAIDLGGTSFRVLKVELGA
GSTIINRKVEHQPIPENLTKGTSDDLFNFIASALKNFIEREGGEVEGRALGFTFSFPVRQ
TSISSGTLIRWTKEFSIEEAVGKDVAQCLNEALARNGLNMKVNVLVNNTVGTLALGHYYD
DDTVAAVIIGAGTNACYIERNDAIIKSLGRVTNSERTVVNVEWGSFRPPQIELTPYDICF
NNETWNYYDQGFEKMISGVYLGEIARLVFQKMAEESDIFGTAVDGLSTPFVLSTPNLAAI
REDDSPDLREVGKILEEHLKLPDVPLKTRKLVARVSDIITRRAARLAAAAIVAILQKIGC
DGTLCGSTQVRTMRGVRRRTVVAIEGGLFEGYSVFREYLNEALVEILGEEIAATVSLRVM
EEGSGTGAALLAAAYSSARQKNSE
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggaggggagggcggcggggtgggtgagggtggcggcggtggggtgggcggtggcggcg
tgcgcggtggcggcggggatggtggcgaggcgaggggcggcgagggtgcggtggaacagg
gcggtggcggtggtgcgggacctggaggagcggtgcgccacgcccgcggagctgctgcag
cgggtggtcaactcgctggccatcgagatgttcgccggcctcgcctccgacggcgggagc
aaggtgcggatgctgctcacctgcgtcgacgcgctccccgacgggagcgaggaaggcatc
agttatgccattgatcttggaggaacaagctttagagtcctgaaagtagaacttggcgca
gggtctacaatcatcaatcgaaaagttgaacatcagcctatccccgaaaatttgactaag
ggtacaagcgatgatttgttcaatttcattgcctcggcactgaagaattttattgaaaga
gagggtggggaggttgaggggagggcacttggttttacattttctttccctgtgagacag
acttccatttcctcggggacattaattcgatggactaaagaattttcaattgaagaggct
gtcgggaaagatgttgctcagtgcctaaatgaagcccttgctaggaatggactcaatatg
aaggtcaatgtattggtgaacaatactgtggggacattagctctcgggcattattatgat
gatgacacagtagctgctgtgattattggagctggcaccaatgcttgctatattgaacgc
aacgatgcaattattaaatctttgggtcgcgttaccaattctgaacgaacggtagtaaat
gtggaatggggtagttttcggcctccacaaatagaattgactccttatgatatatgcttc
aacaacgaaacatggaattattatgaccagggttttgagaaaatgatctctggtgtgtat
cttggggaaattgcaagattggtgttccaaaaaatggctgaagagtcagatatatttggt
actgctgttgatggtctatcgacccctttcgtcttaagtacaccaaacttagctgctatc
cgcgaggatgattccccggacttgagagaagtcggcaagatacttgaggaacatcttaag
ctaccagatgttcccctcaagacccggaagcttgttgccagagtctccgacatcatcacc
cggagagctgcccgcctagcagcggctgcgattgtcgcgatactgcaaaagatcggctgc
gatggaaccctttgtggttcaactcaggttcgaacaatgcgaggcgtgcgaagaagaacg
gtggtcgcgatcgagggcggcctcttcgaaggctactcggtcttcagagagtatctgaat
gaagctctagttgagatccttggagaggagattgcagccactgttagtcttagggtgatg
gaggagggatctgggactggtgctgccctccttgcagctgcatattcatcggctaggcag
aagaactccgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324666
Entry
4324666           CDS       T01015                                 
Name
(RefSeq) hexokinase-9 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4324666
   00051 Fructose and mannose metabolism
    4324666
   00052 Galactose metabolism
    4324666
   00500 Starch and sucrose metabolism
    4324666
   00520 Amino sugar and nucleotide sugar metabolism
    4324666
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4324666
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324666
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4324666
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4324666
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 4324666
NCBI-ProteinID: XP_015614778
UniProt: Q2KNB7 A2ZXD4
LinkDB
Position
1:30131324..30135227
AA seq 502 aa
MRKAAALASAAMAAAAVAVVSTVLHQRQRRAAKRSERAEAVLLRDLQERCAAPVELLRQV
ADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYALDLGGTNFRVLRVQLGGKE
RRIIKQDSEGISIPQHLMSSSSHELFDFVAVALAKFVASEGEDCHLPEGTQRELGFTFSF
PVKQKSLASGTLIKWTKSFAIDEMVGKDVVAELNMAIRSQGLDMKVTALVNDTVGTLAAG
RYVNHDTIAAVILGTGSNAAYIDHADAIPKWHGSLPKSGNMVINMEWGNFKSSHLPLTEF
DQELDAESLNPGKQVYEKSISGMYMGELVRRILLKMAQETRIFGDNIPPKLERPYILRTL
DMLIMHHDTSSDLRTVANKLKEVLGIEYTSFTTRKLVLDVCEAIATRGARLAAAGIYGII
QKLGQHSDSPSTRRSVIAVDGGVYKYYTFFSQCMESTLSDMLGQELAPSVMIKHVNDGSG
VGAALLAASYSQYHQAESADSS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaggaaggcggcggcgctggcgtccgcggcgatggccgcagcagcagtagcggtagtc
tccacggtgttgcaccagaggcaacgtcgggcggcgaagcggtcagagcgcgcggaggcc
gtgctgctgcgggacctgcaggagcggtgcgccgcgccggtggagctgctgcggcaggtg
gcggacgcgatggccgcggagatgcgcgcggggctcgccgccgagggcgggagcgacctc
cagatgctcgtcacctacgttgactccctcccctccgggggtgagaaagggatgttttat
gcacttgaccttggaggaacaaatttccgtgttttacgagttcaattaggaggcaaagaa
cgtcgaattatcaagcaagactcagaagggatatccattccacaacatttaatgtccagc
agttcacatgagttgtttgattttgttgctgtggctttagcaaaatttgttgcctctgaa
ggtgaagactgccatcttcctgagggtacccaaagagaactaggttttacattctccttt
ccagtgaaacaaaaatcattggcatctggcactcttatcaagtggacgaagagttttgca
attgatgaaatggtcggcaaggatgttgtggctgaattaaacatggctatcagaagtcaa
ggacttgatatgaaagtcacagcattggttaatgatacagtagggacattagctgctggg
agatatgtgaatcatgatactattgctgctgttatactgggaacaggtagtaatgcagcg
tacatagatcatgcagatgcaattccaaaatggcatggatccctgcccaagtctggaaat
atggtaataaacatggaatggggtaactttaagtcctcacatcttccacttactgaattt
gatcaagagttggatgcagaaagtttgaaccctggcaaacaggtttacgagaaatcgatt
tctggtatgtatatgggggaacttgttcgaagaatcttactaaagatggctcaagaaact
cgcatttttggtgataatatacctccaaaacttgagagaccatacatcttaaggacactt
gacatgctgatcatgcatcatgatacatcatctgatctcagaacagttgccaacaagttg
aaagaagtcttggggatcgaatatacctctttcacgacgaggaaactggttttggatgtt
tgtgaggccattgcgacacgcggtgcacggcttgctgctgctgggatatatggcattatc
caaaagcttggtcagcattctgacagccccagtacgagaaggtccgtgattgctgtggat
ggaggggtctataaatactacactttcttcagccagtgcatggagagcactctgagtgac
atgcttgggcaggagctggccccctctgttatgatcaagcatgtcaatgatggctcaggc
gttggggcagctctcctggcagcctcttattctcaataccaccaggctgaatctgcagat
agttcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326516
Entry
4326516           CDS       T01015                                 
Name
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326516
   00051 Fructose and mannose metabolism
    4326516
   00052 Galactose metabolism
    4326516
   00500 Starch and sucrose metabolism
    4326516
   00520 Amino sugar and nucleotide sugar metabolism
    4326516
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4326516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326516
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4326516
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4326516
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 Polyoma_agno
Other DBs
NCBI-GeneID: 4326516
NCBI-ProteinID: XP_015621344
UniProt: Q2KNB4
LinkDB
Position
1:complement(41305712..41314573)
AA seq 500 aa
MGRVGLGVAVGCAAVTCAIAAALVARRASARARWRRAVALLREFEEGCATPPARLRQVVD
AMVVEMHAGLASDGGSKLKMLLTFVDALPSGSEEGVYYSIDLGGTNFRVLRVQVGAGSVI
VNQKVEQQPIPEELTKGTTEGLFNFVALALKNFLEGEDDQDGKMALGFTFSFPVRQISVS
SGSLIRWTKGFSIRDTVGRDVAQCLNEALANCGLNVRVTALVNDTVGTLALGHYYDEDTV
AAVIIGSGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNFWSSHLPRTPYDILLDDET
HNRNDQGFEKMISGMYLGEIARLVFHRMAQESDVFGDAADSLSNPFILSTPFLAAIREDD
SPDLSEVRRILREHLKIPDAPLKTRRLVVKVCDIVTRRAARLAAAGIVGILKKLGRDGSG
AASSGRGRGQPRRTVVAIEGGLYQGYPVFREYLDEALVEILGEEVARNVTLRVTEDGSGV
GAALLAAVHSSNRQQQGGPI
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggggagggtggggctcggcgtggcggtggggtgcgcggcggtgacctgcgcgatcgcc
gcggcgctcgtggcgcgcagggcgtcggcgcgggcgcggtggcggcgggcggtggcgctg
ctgcgggagttcgaggaggggtgtgccacgccgcccgcgaggctgcgccaggtcgtggac
gccatggtcgtcgagatgcacgccggcctcgcgtccgatggcggcagcaagctcaagatg
ctgctcaccttcgtcgacgcgctccccagcgggagtgaagaaggtgtatattattctatt
gatcttggaggaacaaacttcagagtcttgagggtacaagttggtgcgggatctgtgatc
gtcaaccaaaaggttgaacagcaacccatccctgaggaactgaccaaaggcactactgag
ggtttattcaactttgttgccctggcactaaagaattttcttgaaggagaagatgaccaa
gatggaaaaatggcacttggttttacattttctttccctgttagacaaatttcagtgtct
tcagggtcattaattaggtggacaaaaggattttccatcagagacacggttggcagagat
gttgctcagtgcttaaatgaagcgcttgccaattgtgggctaaatgtgcgggtcactgca
ttggtgaatgatacagtggggacattagctctagggcattactatgatgaagacacagtg
gctgctgtgataattgggtctggcaccaacgcttgctacattgaacgcactgatgcaatt
atcaagtgccagggtcttctaacgaactctggaggcatggtagtaaacatggagtggggg
aatttctggtcatcacatttgccaaggacgccatatgacatcttgctggatgatgaaaca
cacaatcgcaatgatcagggctttgagaaaatgatatcaggaatgtatcttggggaaatt
gcaagattggtatttcatagaatggcccaggaatcagatgtttttggtgatgctgctgat
agtctatccaaccctttcattttgagcacaccgtttctggccgcaattcgcgaggacgat
tcaccagatctgagcgaagtcagaaggatacttcgagaacatctgaagattcccgatgct
cctctgaaaactcgacggctggtcgtgaaagtctgcgacattgtgactcgcagagccgcc
cgtctagccgctgcaggcatcgtggggatactgaagaagctggggagggatgggagcggc
gcggcgtcgagcgggagaggtagagggcagccgaggaggacggtggtggcgatcgagggc
gggctgtaccagggttacccggtgttcagggagtacctggacgaggccctggtggagatc
ctgggggaggaggtggcgcggaacgtgacgctgagggtgacggaggatgggtcgggggtc
ggggctgccctcctcgccgccgtacattcgtcgaatagacagcaacaaggaggtcccata
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326547
Entry
4326547           CDS       T01015                                 
Name
(RefSeq) hexokinase-6
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326547
   00051 Fructose and mannose metabolism
    4326547
   00052 Galactose metabolism
    4326547
   00500 Starch and sucrose metabolism
    4326547
   00520 Amino sugar and nucleotide sugar metabolism
    4326547
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4326547
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326547
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4326547
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4326547
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF3824 Sir1 DUF3042 FTZ
Other DBs
NCBI-GeneID: 4326547
NCBI-ProteinID: XP_015618116
UniProt: Q8LQ68
Structure
LinkDB
Position
1:complement(31009687..31013954)
AA seq 506 aa
MGKGTVVGTAVVVCAAAAAAVGVAVVVSRRRRSKREAEEERRRRAAAVIEEVEQRFSTPT
ALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGEDFHLPEGRQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVAAAVILGTGTNAAYVEHANAIPKWTGLLPRSGNMVINMEWGNFKSER
LPRSDYDNALDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPTKLEQR
FILRTPDMSAMHHDTSHDLKHLGAKLKDILGVADTSLEARYITLHVCDLVAERGARLAAA
GIYGILKKLGRDRVPSDGSQKQRTVIALDGGLYEHYKKFRTCLEATLADLLGEEAASSVV
VKLANDGSGIGAALLAASHSQYASVE
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggggaaggggacggtagtggggacggcggtggtggtgtgcgctgcagcggccgcggcg
gttggggtggcggtggtggtgtcgcggaggaggaggagcaagcgggaggcggaggaggag
cggcggaggagggccgccgctgtgatcgaggaggtggagcagaggttctcgacgcccacg
gcgctgctgcgcggcatcgcggacgccatggtggaggagatggagcgcggcctccgcgcc
gaccctcacgccccgctcaagatgctcatcagctacgtcgacaacctccccaccggggat
gagcacggactgttctatgctctcgatcttgggggcaccaatttccgtgttatacgtgtt
cagcttggaggaagggaaaagcgtgttgttagtcaacagtacgaagaggttgccattcca
cctcacctgatggttgggacttctatggaactgtttgacttcattgcggctgagttggaa
agttttgtcaagaccgagggagaggatttccacttgccagagggcaggcagagagagtta
ggcttcaccttttctttcccagtgcaccaaacatcaatatcatcaggcactcttattaag
tggacaaagggattttccatcaatggcacggtgggggaagatgttgtggctgaattgagc
agggctatggaaaggcaagggcttgatatgaaagttacagctcttgttaatgacactgta
ggcacattggctggcggaagatatgttgataatgacgttgctgctgctgtaatattaggc
actggcacaaacgcagcctacgtggagcatgcaaatgcaattccaaaatggactggatta
ctacctagatcaggaaatatggtgattaacatggaatggggaaacttcaagtcagaaagg
cttcctcgttcagattacgataatgccttggactttgaaagtttaaacccaggcgagcag
atatatgaaaagatgatttccggcatgtatcttggagagattgtgcgcagaatcttgctt
aagcttgctcatgatgcttccttgtttggagatgttgttccaacaaagctggagcagcgc
tttatactgaggacgccggacatgtcagcgatgcatcatgatacctcacatgatctgaaa
cacctgggagctaagctgaaggatatcctgggggtcgctgatacttccctggaagcacga
tacatcacccttcatgtctgcgacctcgttgcagagagaggtgcacgcttagctgctgct
ggtatatatggcattctaaagaagctgggcagggacagagtgccaagtgacggtagtcaa
aagcagaggactgtcattgctctggatggtggtctctatgagcattacaagaagttcaga
acctgcctagaagcaacgcttgcagacctgcttggagaggaggctgcctcatcagttgtt
gtcaagttggcaaacgatggctctggcatcggagctgcacttcttgcagcatctcactcc
cagtatgctagcgtcgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326776
Entry
4326776           CDS       T01015                                 
Name
(RefSeq) hexokinase-8 isoform X2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326776
   00051 Fructose and mannose metabolism
    4326776
   00052 Galactose metabolism
    4326776
   00500 Starch and sucrose metabolism
    4326776
   00520 Amino sugar and nucleotide sugar metabolism
    4326776
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4326776
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326776
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4326776
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4326776
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 4326776
NCBI-ProteinID: XP_015622019
UniProt: Q1WM15
LinkDB
Position
1:complement(4820124..4823320)
AA seq 458 aa
MAAVEAEKVVAELRERCATPASLLRDVAAAMAGEMGAGLEKEGGSRVKMLLSYVDKLPTG
REDGLFYGLDLGGTNFRVLKVHLGGSKKHVVNSESREVSIPPHLMSGTSSELFGFIAGEL
GKFVAEEEEGTDMPNGKKKELGFTFSFPVRQRSVASGTLVKWTKAFSIDDAVGEDVVAEL
QTAMVKQGLDMHVAALINDAVGTLAGARYYDEDVVAGVIFGTGTNAAYVEKANAIPKWEG
ELPNSGDMVINMEWGNFYSSHLPVTEYDEALDKESLNPGEQIYEKLTSGMYLGEIVRRVL
LKLSLQSGIFGSIDNSKLKTCFHLRTPHISAMHHDETPDLKIVAEKLHQILEITHTSLEI
RKMVVEICDIVARRAARLAAAGVAGILMKLGRNGGINNQRSVIAIDGGLFEHYTKFRECL
ESTLGELLGEEASKSVAVKHANDGSGIGAALIAASQSR
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcggcggtggaggcggagaaggtggtggcggagctgcgggagaggtgcgcgacgccg
gcgtcgctgctgcgggatgtggcggcggcgatggccggcgagatgggcgccggcctggag
aaggagggtgggagcagggtcaagatgctgctctcctacgtcgacaagctccccactggg
agagaggatggattgttctatggattggacctaggaggaacaaacttccgggtgctcaag
gttcatcttggtggcagcaagaagcatgtcgtcaactctgaatccagggaagtcagcatc
ccaccacacctgatgtcagggacctcctcggaattgtttggtttcattgctggggaatta
ggcaagtttgttgctgaagaggaggagggtactgacatgccaaacggcaagaagaaagag
ctaggattcaccttctcttttcctgtgaggcaacgatctgtggcatcgggtacccttgtc
aagtggacaaaggcgttttccattgatgatgcagtaggtgaagatgtggtggctgaacta
caaacggctatggtgaaacaaggtctggacatgcatgtagctgcattgattaatgatgct
gttggaacattggctggagcaagatactacgatgaagatgttgtcgcaggtgtgatattt
ggtactggcacaaatgctgcatatgttgagaaggcaaatgctataccaaaatgggaaggg
gagttgcccaattcaggggatatggtcatcaatatggaatggggtaatttctattcatcg
catcttccagttactgaatacgatgaagcattagacaaggaaagcttaaaccctggagag
cagatatatgagaagttaacatcaggaatgtatttaggtgaaatcgtaagaagagtgctg
cttaaactgtccttgcagtctggaattttcggttctatagataactccaagctcaaaact
tgtttccatctgcggactccgcacatttctgcaatgcaccatgatgaaacacctgaccta
aagatagtggctgaaaaattgcatcaaatcctagagattacacatacatccttagagata
aggaaaatggttgtcgaaatatgcgatatcgtggcaaggagggcagctcggctggctgct
gctggtgttgcagggatcctcatgaagcttggaagaaatggcggcatcaacaatcagcgc
tcggtcatcgccattgatggaggtttgttcgaacactacaccaaattcagggaatgtttg
gagagcacgttgggtgagttgctgggagaggaggcttccaagtcggtagccgtcaagcac
gcgaacgacgggtcagggataggggctgcccttattgcagcctctcaatctcgatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338010
Entry
4338010           CDS       T01015                                 
Name
(RefSeq) hexokinase-7
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338010
   00051 Fructose and mannose metabolism
    4338010
   00052 Galactose metabolism
    4338010
   00500 Starch and sucrose metabolism
    4338010
   00520 Amino sugar and nucleotide sugar metabolism
    4338010
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4338010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4338010
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4338010
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4338010
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF6704
Other DBs
NCBI-GeneID: 4338010
NCBI-ProteinID: XP_015637554
UniProt: Q1WM16
LinkDB
Position
5:complement(5337212..5341257)
AA seq 463 aa
MVAAAVAAAEQVVAALREECATPAARLDGVAAAMAGEMAAGLAEEGGSKIKMIVSYVDNL
PNGTEEGLFYALDLGGTNFRVLRVQLAGKEKRVVKRESREVSIPPHLMSGNSSELFGFIA
SALAKFVADEGHNAVFNDRQRELGFTFSFPVRQTSIASGTLIKWTKAFSIDDAVGEDVVA
ELQMAMEKQGLDMRVSALINDTVGTLAAGSYYDEDIVVGVILGTGSNAAYLEKANAIPKL
EGELPKSGNMVINTEWGNFSSSCLPITEYDEALDKESLNPGEQIFEKLISGMYLGEIVRR
VLLKISLQSSIFGNLDQTKLKTRFILRTPDISVMHHDGTPDLRIVAEKLADNLKITDTSL
ETRKMVVEICDIVTRRSARLAAAGIVGILRKIGRGVPGDKRKSVIAIDGGLYEHYTEFRQ
CLETTLTELLGEEASKSVAVKLANDGSGLGAALIAAAHSQYLN
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggtggcggcggcggtggcggcggcggagcaggtggtggcggcgctgcgggaggagtgc
gcgacgccggcggcgcggctggatggggtggcggcggcgatggccggcgagatggcggcg
gggttggcggaggagggcggcagcaagatcaagatgatcgtttcctacgtcgacaacctc
cccaatgggaccgaagagggcttgttctacgcgctggatcttgggggaacaaacttccga
gtcctgcgtgtgcagcttgctggaaaggagaaacgggtcgtgaagcgcgagtcgagggag
gtctcgatccctccccatctcatgtccggcaactcctcggagctgtttggcttcatcgct
tccgcgttagccaagttcgtcgctgatgaaggacataatgccgtgttcaacgacaggcaa
agggaactggggttcaccttctctttccctgtgcggcaaacatcgattgcgtctgggact
cttatcaagtggaccaaggcgttttctattgatgatgctgtaggtgaagatgtggtggcc
gaattgcagatggccatggagaagcaaggtctggacatgcgcgtttccgcattgatcaat
gacactgttgggacattggcggcaggcagctactacgacgaagatattgtcgtcggtgtg
atcttaggcactggctcaaacgccgcatatcttgagaaggcaaatgctatccctaagttg
gaaggcgagttaccaaaatcaggaaacatggttattaatacagaatggggtaacttctcc
tcatcctgtcttccaataacagaatatgatgaagcactagataaagagagcttaaaccct
ggagagcagatcttcgagaaattgatttcaggaatgtatctaggtgaaatcgtaaggaga
gtgcttcttaaaatatctttgcagtcttcaatttttggcaatctagatcagaccaagctc
aaaacccgctttattctgaggactcctgatatttccgtgatgcatcatgatggaacacct
gatctcagaattgtggctgaaaaacttgcagataacctgaagatcacagacacatcctta
gaaacaaggaagatggttgtcgaaatctgtgacatcgtcacccgaagatcagcccggctg
gctgctgctgggatcgtagggatcctcaggaagatcggcagaggcgtcccaggcgacaag
cgaaagtcggtcatcgccatcgatggcggtctatatgaacattacaccgaattccggcag
tgcctggagaccacgctgacggagttgctcggagaagaggcgtcgaagtcggtggctgtc
aagcttgcaaacgacgggtctggccttggagctgccctgattgcagctgctcattctcag
tacctgaattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339361
Entry
4339361           CDS       T01015                                 
Name
(RefSeq) hexokinase-5
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339361
   00051 Fructose and mannose metabolism
    4339361
   00052 Galactose metabolism
    4339361
   00500 Starch and sucrose metabolism
    4339361
   00520 Amino sugar and nucleotide sugar metabolism
    4339361
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4339361
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339361
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4339361
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4339361
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 4339361
NCBI-ProteinID: XP_015639323
UniProt: Q5W676
LinkDB
Position
5:26017283..26022343
AA seq 507 aa
MGKAAAVGTAVVVAAAVGVAVVLARRRRRRDLELVEGAAAERKRKVAAVIEDVEHALSTP
TALLRGISDAMVTEMERGLRGDSHAMVKMLITYVDNLPTGNEQGLFYALDLGGTNFRVLR
VQLGGKEKRVVQQQYEEVSIPPHLMVGTSMELFDFIASALSKFVDTEGDDFHLPEGRQRE
LGFTFSFPVSQTSISSGTLIKWTKGFSINDAVGEDVVSELGKAMERQGLDMKIAALVNDT
VGTLAGGRYADNSVVAAIILGTGTNAAYVENANAIPKWTGLLPRSGNMVINTEWGSFKSD
KLPLSEFDKAMDFESLNPGEQIYEKLISGMYLGEIVRRILLKLAHDAALFGDVVPSKLEQ
PFVLRTPDMSAMHHDSSHDLKTVGAKLKDIVGVPDTSLEVRYITSHICDIVAERAARLAA
AGIYGVLKKLGRDKMPKDGSKMPRTVIALDGGLYEHYKKFSSCLESTLTDLLGDDVSSSV
VTKLANDGSGIGAALLAASHSQYAEID
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggggaaggcggcggcggtggggacggcggtggtggtggccgcggcggtcggggtggcg
gtggtgctggcgcggaggcggaggaggagggacctggagctggtggagggagccgcggcg
gagaggaagaggaaggtggcggcggtgatcgaggacgtggagcacgcgctgtcgaccccg
acggcgctgctgcggggcatctcggacgccatggtcaccgagatggagcgaggcctgcgc
ggggacagccacgccatggttaagatgctcatcacctacgtcgacaacctccccaccgga
aatgaacaggggttgttttatgcattggatcttggaggaaccaacttccgcgtcctgcga
gtccaactcggtggcaaggagaaacgtgtcgtccaacaacagtacgaggaagtctcaatt
ccaccacatctgatggttggaacttccatggaactgtttgattttattgcttctgcattg
tcaaaatttgttgatactgaaggtgatgatttccacctcccagaagggagacagagagag
ctgggcttcaccttttccttcccagtgagccagacatcaatatcgtcaggaacgctcatc
aagtggacaaagggtttctccatcaatgacgcggttggcgaagatgttgtatctgagttg
ggcaaggccatggagaggcagggattagatatgaaaattgcagcattggttaatgacact
gtcggcacattggctggtgggaggtatgcggataacagtgttgttgctgctataatattg
ggcactggtacaaatgcagcatatgttgagaatgctaatgcaattcctaaatggaccggt
ttactgcctaggtccggaaatatggtaatcaacacagaatgggggagctttaaatcagat
aagcttcctctttcagaattcgataaagcaatggattttgaaagcttgaatcctggagag
cagatatatgaaaagttgatttctggcatgtatcttggagagatagtgcgaagaatcttg
ctgaagcttgctcatgatgcagctttgtttggggatgttgttccatctaagctagagcaa
ccgtttgtactaaggacaccggatatgtcagccatgcatcatgactcgtcacatgacctt
aaaactgttggagctaagctaaaggatatcgtcggggtcccagatacttccctggaagta
agatacattaccagtcacatttgtgacatagttgcagagcgtgctgcacgcttggctgct
gctggcatatatggggtcctaaagaagctaggtcgggacaagatgccaaaagacggcagt
aagatgcctaggactgtcattgccttggatggtgggctctatgaacattacaagaagttc
agcagttgcttagaatcaactctaacagaccttcttggggatgatgtctcgtcttcggtg
gttaccaagctggccaacgatggttctggcattggagctgctcttctcgcagcctcgcac
tcccagtatgccgagatcgactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339420
Entry
4339420           CDS       T01015                                 
Name
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339420
   00051 Fructose and mannose metabolism
    4339420
   00052 Galactose metabolism
    4339420
   00500 Starch and sucrose metabolism
    4339420
   00520 Amino sugar and nucleotide sugar metabolism
    4339420
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4339420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339420
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4339420
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4339420
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 4339420
NCBI-ProteinID: XP_015637797
UniProt: Q2KNB9 B9FH43
LinkDB
Position
5:complement(26418671..26422551)
AA seq 494 aa
MRKAAAAAVAAAAAVGVALLVRRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMA
VEMHAGLASEGGSKLKMIISYVDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIK
QEHDEISIPPHLMTGGSNELFDFIASSLAKFVASEGEDFHLAEGRQRELGFTFSFPVKQT
SIASGTLINWTKGFSIDETVGEDVVTELTKALERQGLDMKVTALINDTIGTLAGGRYDDN
DVIAAVILGTGTNAAYVERANAIPKWHDLLPKSGDMVINMEWGNFRSSHLPLTEFDQALD
AESLNPGEQVYEKLISGMYLGEIVRRVLLKMAEEASLFGDEVPPKLKIPFIIRTPYMSMM
HCDRSPDLRTVGAKLKDILGVQNTSLKTRRLVVDVCDIVAKRAAHLAAAGIHGILKKLGR
DVPNTDKQRTVIAVDGGLYEHYTIFAECVESTLRDMLGEDVSSTIVIKLAKDGSGIGAAL
LAAAHSQYREAEEL
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaggaaggcggcggcggcggcggtcgcggcagcggcggcggtcggcgtggcgctgctg
gtgcgccggcagctgcgggaggcgaagcggtggggccgggccgacgcggtgctgcgggag
ctggaggagcggtgcgcggcgccgccggggcggctgcggcaggtggcggacgcgatggcc
gtcgagatgcacgccgggctcgcctccgagggcgggagcaaactcaagatgatcatcagc
tacgtcgacgccctcccttccggggaagagaagggggtgttttatgcgcttgaccttgga
ggtacaaatttccgtgttttacgggttcaattaggtggcaaggaagggagagttatcaag
caagaacatgacgagatttcaattcctccgcatctgatgactggtggttcaaatgaacta
tttgattttattgcttcttctttagcaaaatttgttgcttcagagggtgaagactttcat
cttgctgaggggaggcagagagaacttggctttacgttctctttcccagtaaagcaaact
tcaattgcatctggcactcttattaattggactaagggtttttcgattgatgaaacggtt
ggtgaagatgttgtgactgaattaaccaaggctcttgaacgccaggggcttgatatgaaa
gtcacagcattgataaatgatactatagggacattggctggtgggagatatgatgataat
gatgtcattgctgctgttatactgggaacaggtactaatgcagcatacgtggaacgtgcc
aatgcaattcctaaatggcatgacctcctgccgaagtcaggagatatggtaataaatatg
gaatgggggaacttcaggtcatcccatcttcctttgactgaatttgatcaagcattagat
gctgaaagtttgaatcctggtgaacaggtttacgaaaagttgatctctggcatgtatttg
ggagaaattgttcgtagagtcctattaaagatggctgaagaagcttctctttttggtgat
gaagtaccaccaaaactcaagattccatttattatcaggactccatacatgtcaatgatg
cactgcgacagatcacctgatctcagaacagttggagcgaaactgaaagatatcctgggg
gtccaaaacacctcccttaaaacaagaaggcttgtggtggatgtctgcgacatcgttgcg
aaacgcgccgctcaccttgctgctgcagggatacacgggatcctgaagaagcttgggcgc
gacgtccccaacaccgacaagcagaggacggtgatcgccgtcgacggtgggctctacgag
cactacaccatcttcgccgagtgcgtggagagcaccctgagggacatgcttggggaggat
gtgtcctccaccattgtcatcaagctcgccaaggacgggtcaggcattggcgctgctctc
cttgctgcggctcattctcaataccgtgaggctgaggagctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342654
Entry
4342654           CDS       T01015                                 
Name
(RefSeq) hexokinase-4, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4342654
   00051 Fructose and mannose metabolism
    4342654
   00052 Galactose metabolism
    4342654
   00500 Starch and sucrose metabolism
    4342654
   00520 Amino sugar and nucleotide sugar metabolism
    4342654
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4342654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342654
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4342654
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4342654
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 4342654
NCBI-ProteinID: XP_015645316
UniProt: Q6Z398
LinkDB
Position
7:5256325..5259781
AA seq 509 aa
MSAAAAIASPIPAAIAVVQQQRRGRSRGGGSGAAAVRCSAVAPTSAIAPILADLRLRCAA
PLPVLRRVADAMASGMRAGLADDGAGELKMIPSHVYSLPTGNETGLFYALDLGGTNFRVL
RVQLGGKDKRIIDTEFEQVSIPREIMHGITEDLFDFIASGLSRFVATEGDKFHLPQGRKR
ELGFTFSFPVNQTSIDSGILIKWTKGFAVSGTAGKDVVACLNAAMERQGLDMRVSALVND
TVGTLAGARYWDDDVMVAVILGTGTNACYIQRTEAIPKLQHLKLETGNTIINTEWGAFSD
GLPLTEFDREMDDESINPGEQIFEKTISGMYLGEIVRRVLVKMAEVSDLFGHSFPKKLAE
PFVLRTPHLCAMQQDTSDNLGEVESILSDVIGVSQASLLARRVTVEVSDCIIRRGGRLAG
AGIVGILEKMENDSRGHIFGRRTVVAMDGGLYEKYPQYRRYMKEAVAELLGPERSNRIAI
EHTKDGSGIGAALLAAANSKYAAAQISTR
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtccgccgccgccgccatcgcgtcgccgatcccggcggcgatcgccgtcgtgcagcag
cagaggcgggggaggagccgcggcggcggctccggcgctgccgccgtccgctgctccgcg
gtggccccgacgtccgcgatcgcgcccatccttgccgacctgaggctgcggtgcgccgcc
ccgctccccgtgctgcggcgcgtggcggacgccatggcctccgggatgcgcgccgggctg
gccgacgacggcgccggcgagctcaagatgatccccagccacgtctactcactccccact
gggaatgaaacaggactgttttatgctctggaccttggaggcaccaactttagagtgctg
agggtacaattgggaggaaaagataagcgcattatagataccgagtttgagcaagtctcg
atcccaagagaaatcatgcatggtataaccgaggatttgtttgatttcatcgcgagtggc
ctgtcgagatttgtagcaacggagggtgataagtttcatttgccacaagggagaaagaga
gagttaggcttcacattctcctttccggtgaatcagacttctattgattctggcattctg
atcaagtggacaaaaggttttgctgtctctggaactgctgggaaagatgttgttgcttgt
ctgaatgctgcaatggagaggcaaggccttgatatgcgtgtctctgccttggtaaatgat
actgtgggaaccttagctggagcacgttattgggacgatgacgtaatggtcgcggtgatt
ttgggcactggcaccaatgcatgctacattcaacgaactgaagctattccaaaattgcaa
caccttaagcttgaaacaggaaacacgattattaacactgagtggggagctttctcagat
ggacttccattgactgaatttgacagagaaatggatgatgagagcataaatcctggtgaa
cagatattcgagaagacgatttccgggatgtatctaggtgaaattgtccgtagggtgctg
gtcaagatggctgaagtatctgatctctttggtcattccttccccaagaaacttgctgaa
ccatttgttctaaggacaccacatctatgcgctatgcaacaagacacctctgacaatctt
ggagaagttgagtccatcttgagtgatgtcatcggcgtgtcccaagcttctctgctggca
cggagagtcactgtagaagtctccgactgcatcatcaggagaggaggccggttggccggg
gcaggaatcgtagggatccttgagaagatggagaatgactccagagggcacattttcgga
cgaagaacagtggtcgcgatggacggtggtctatatgagaagtaccctcagtacaggagg
tacatgaaggaggctgtggctgagctactgggacccgagcgatcgaatcgtatcgccatc
gagcacacgaaagacggatcagggatcggcgctgcgctgttggcagctgcaaactcaaag
tatgctgctgctcaaatctctacaaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343113
Entry
4343113           CDS       T01015                                 
Name
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4343113
   00051 Fructose and mannose metabolism
    4343113
   00052 Galactose metabolism
    4343113
   00500 Starch and sucrose metabolism
    4343113
   00520 Amino sugar and nucleotide sugar metabolism
    4343113
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    4343113
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343113
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     4343113
Membrane trafficking [BR:osa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    4343113
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 4343113
NCBI-ProteinID: XP_015645221
UniProt: Q8LH82
LinkDB
Position
7:15292763..15294856
AA seq 498 aa
MAAAAVAADQKVVTMTSLREGCACAAPPAAAAPPMPKMAAAQRVVAELREACATPAARLA
EVAAAMAGEMEAGLAVEGGSSEMKMIVSYVDSLPTGGEEGSYYALDLGGTNFRVLRVRLA
GGGVAERVAREVPIPPGLMSGGGATSECLFGFIASALAEFVGEEEEEGGLDGGERELGFT
FSFPVHQTSIASGTLIRWTKAFAVDDAIGEDVVAALQAAMSERGLDMRVSALINDTVGTL
AAGSYYDEDVVAAVILGTGTNAAYVEDATAIAKLHPSQLPASNTMVINTEWGSFASPCLP
LTEFDEALDQESLNPGEQTYEKLISGMYLGEIVRRVLLKISSRCPSLLGGAGELATPFVL
RTPDVSAMHHDETPDLSIVGEKLERTLGIRGTSPEARRMVVEVCDIVATRAARLAAAGIV
GILKKIGRVDGGEGRRRRSVVAVDGGLFEHYGKFRRCMESAVRELLGEAAAERVVVKLAS
DGSGLGAALVAAAHSQRA
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggtggcggcagatcagaaggtggtgacgatgacgagcctccgggag
ggctgcgcttgcgcggcgcctcctgctgcagctgcgccgccgatgccgaagatggcggcg
gcgcagagggtggtggcggagctgagagaagcgtgcgcgacgccggcggcgaggctggcg
gaggtggccgcggcgatggccggcgagatggaggccgggctggcggtggagggcggcagc
agcgagatgaagatgatcgtgtcgtacgtcgacagcctccccaccggcggcgaggagggg
tcgtactacgcgctcgacctcggcggcaccaacttccgcgtcctccgcgtgcggcttgcc
ggcggcggcgtcgccgagcgcgtggcgagggaggtcccgatccctcccggcctcatgtcc
ggcggcggcgccacctcggagtgcctcttcggcttcatcgcctccgcgctagccgagttc
gtcggcgaggaggaagaagaaggcggcctcgacggcggcgagagggagcttgggttcacc
ttctccttccccgtgcaccaaacctccatcgcgtcggggacgctcatccggtggacgaag
gcgttcgccgtcgacgacgcgatcggcgaggacgtcgtggcggcgctgcaggcggccatg
tcggagcgggggctcgacatgcgcgtgtcggcgctcatcaacgacaccgtcgggacgctc
gccgcgggcagctactacgacgaggacgtcgtggccgccgtcatcctcggcaccggcacg
aacgccgcctacgtcgaggacgccaccgccatcgccaagctacacccatcgcagctgcca
gcatcgaacaccatggtgatcaacaccgagtggggcagcttcgcctcgccgtgcctccca
ttgacggagttcgacgaagcactcgatcaggagagcctcaaccccggcgagcagacctac
gagaagctcatctccgggatgtacctcggcgagatcgtcaggagggtcctcctcaagatc
tcctcccggtgcccctccctcctcggcggcgccggcgagctcgcgacgccgttcgtcctc
aggacacccgacgtgtccgcgatgcaccacgacgagacgcccgacctgagcatcgtcggc
gagaagctggaacgcacgctgggcatccgcggcacgtcgccggaggcgaggaggatggtc
gtcgaggtgtgcgacatcgtcgccacgagggccgcccggctggccgcggcggggatcgtc
gggatcctgaagaagatcgggagggtcgacggcggcgaggggcggaggaggaggtcggtg
gtcgccgtggacggcgggctgttcgagcactacggcaagttccggcggtgcatggagagc
gcggtgagggagctgctcggagaggcggcggcggagagggtggtcgtcaagctcgccagc
gacggctccgggctcggcgccgccctggttgcagctgctcactcgcagagagcataa

DBGET integrated database retrieval system