KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131463
Entry
3131463           CDS       T01015                                 
Symbol
rbcL, OrsajCp033
Name
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3131463 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3131463 (rbcL)
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3131463 (rbcL)
SSDB
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Other DBs
NCBI-GeneID: 3131463
NCBI-ProteinID: NP_039391
UniProt: P0C512 A0A0K0LQW8
Structure
LinkDB
Position
Pltd:54095..55528
AA seq 477 aa
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEDNQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDFIEKDRAR
GIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIRSACKWSPELAAACEIWKAIKFEFEPVDKLDS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaagtgttggatttaaagctggtgttaaggattat
aaattgacttactacaccccggagtacgaaaccaaggacactgatatcttggcagcattc
cgagtaactcctcagccgggggttccgcccgaagaagcaggggctgcagtagctgccgaa
tcttctactggtacatggacaactgtttggactgatggacttaccagtcttgatcgttac
aaaggccgatgctatcacatcgagcccgttgttggggaggataatcaatatatcgcttat
gtagcttatccattagacctatttgaagagggttctgttactaacatgtttacttccatt
gtgggtaacgtatttggtttcaaagccctacgcgctctacgtctggaggatctgcgaatt
ccccctacttattcaaaaactttccaaggtccgcctcatggtatccaagttgaaagggat
aagttgaacaaatacggtcgtcctttattgggatgtactattaaaccaaaattgggatta
tctgcaaaaaattatggtagagcatgttatgagtgtctacgcggtggacttgattttacc
aaagatgatgaaaacgtaaactcacaaccatttatgcgttggagggaccgttttgtcttt
tgtgccgaagctatttataaatcacaggccgaaaccggtgaaattaaggggcattacttg
aatgcgactgcaggtacatgcgaagaaatgattaaaagagctgtatttgcgagggaatta
ggggttcctattgtaatgcatgactacttaaccggggggttcaccgcaaatactagtttg
gctcattattgccgcgacaacggcctacttcttcacattcaccgagcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcatttccgtgtattagctaaagcattgcgtatg
tctgggggagatcatatccacgctggtacagtagtaggtaagttagaaggggaacgcgaa
atgactttaggttttgttgatttattgcgcgatgattttattgaaaaagatcgtgctcgc
ggtatctttttcactcaggactgggtatccatgccaggtgttataccggtggcttcaggg
ggtattcatgtttggcatatgccagctctgaccgaaatctttggagatgattctgtattg
caatttggtggaggaactttaggacatccttggggtaatgcacctggtgcagcagctaat
cgggtggctttagaagcctgtgtacaagctcgtaacgaagggcgcgatcttgctcgtgaa
ggtaatgaaattatccgatcagcttgcaaatggagtcctgaactagccgcagcttgtgaa
atatggaaagcgatcaaattcgagttcgagccggtagataaactagatagctag

DBGET integrated database retrieval system