KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324825
Entry
4324825           CDS       T01015                                 

Definition
(RefSeq) cytochrome P450 86A1
  KO
K15401  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4324825
   00073 Cutin, suberine and wax biosynthesis
    4324825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4324825
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     4324825
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP86 family
   4324825
SSDB
Motif
Pfam: p450 DUF5858
Other DBs
NCBI-GeneID: 4324825
NCBI-ProteinID: XP_015631717
UniProt: A0A0N7KE31 Q5N7U6
LinkDB
Position
1
AA seq 545 aa
MATDGGVLQLHPYAMAAAAVALASAYMVWFWALSRRLSGPRMWPLVGSLPSVVLNRARVH
DWIADNLRATGDAATYQTCILPLPFLARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQ
ASFHDLLGQGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWANRSIKYRLWRILDDHCN
AAASVDLQDLLLRLTFDNICGLTFGKDPETLSPGLPENPFANAFDEATEATMQRFLFPSL
LWRIKKAFGVGSERSLRDSLAVVDRHMTETIAARKATPSDDLLSRFMKKRDSKGKAFPED
VLQWIALNFVLAGRDTSSVALSWFFWTLMQRRDVERKVVLEIASVLRETRGDDTARWTEE
PLNFDELERLVYLKAALTETLRLYPSVPQDSKYVVADDVLPDGTVVPAGSAITYSIYSVG
RMESIWGKDCAEFRPERWLSADGSRFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIAS
AVLLRNSVELVPGHKVEQKMSLTLFMKNGLRVHVKPRDIASYVEPSEPAPPQGSLVIPTT
TAAAA
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcgaccgatggcggcgtgttgcagctgcacccctacgccatggccgcggctgccgtg
gcattggcttcggcgtacatggtgtggttctgggcgctgtcgcggcggctgtccgggcca
cggatgtggccgctcgtcggcagcctacccagcgtcgtgctgaaccgggcgcgggtgcac
gactggatcgccgacaacctgcgcgccacgggtgacgccgcgacgtaccagacgtgcatc
ctgcctctgccattcctggcgcggcggcaggggctggtgacggtgacgtgcaacccgcgg
aaccttgagcacatcctgcgcgcgcgcttcgacaactaccccaagggccccatgtggcag
gcatcgttccacgacctcctcggccagggcatcttcaactccgacggcgagacgtggctg
atccagcgaaagacggcagccctcgagttcaccacccggacgttgcgccaggccatggca
cgctgggccaaccgctccatcaagtaccgcctgtggcgtatcctcgacgaccactgcaac
gcggccgcaagcgtggacctccaggacctcctcctgcgcctcaccttcgataacatctgc
ggcctcaccttcggcaaggacccagagacgctgtcccccggcttgccggagaaccccttc
gccaacgcttttgacgaggccaccgaggcgacgatgcagaggttcctgttcccgagcttg
ttgtggcgcatcaagaaggcgttcggtgtcggcagcgagcggagcctccgcgacagcctc
gccgtggtggaccgtcacatgacggagaccatcgcggcacgcaaggcgacgccgtcggac
gacctgctgtcccggttcatgaagaagcgcgacagcaagggcaaagcgttcccggaggac
gtgctccagtggatcgcgctcaacttcgtgctcgccgggcgcgacacgtcgtccgtcgcg
ctcagctggttcttctggactctcatgcagaggcgggacgtggagcgcaaggtggtcctc
gagatcgcctccgttctcagggagacgcgcggggacgacacggcgaggtggacggaggag
cctctaaacttcgacgagctggagcgactggtgtacctcaaggcggcattgacggagacg
ctgcggctgtacccgtctgtgccgcaggattccaagtacgtcgtggcggacgacgtgctg
cccgacggcacagtggtgccggccggctcggcgatcacctactccatctactcagtggga
agaatggagagcatatgggggaaggactgcgcagagttccggccggagcggtggctatcg
gccgacggcagccgcttcgagcctgtcaaggacgcgtaccgcttcgtggcgttcaacggc
gggccgcgaacgtgcctcggcaaggacctggcctacctgcagatgaaatccatcgcgtcc
gccgtgctgctgcgcaactcggtggagctcgtgccggggcacaaggtggagcagaagatg
tcgctgacgcttttcatgaagaatggactgcgagtgcacgtcaagccgagggacattgcc
agctacgtcgagccgtcggagccggcgccgccgcagggctccctcgtgataccgactacc
accgcagccgctgcgtag

DBGET integrated database retrieval system