KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325309
Entry
4325309           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4325309
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325309
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     4325309
SSDB
Motif
Pfam: PEPcase PEPcase_2
Other DBs
NCBI-GeneID: 4325309
NCBI-ProteinID: XP_015630901
UniProt: A0A8J8Y207 B9EZR3
LinkDB
Position
1:complement(31859332..31865447)
AA seq 966 aa
MARNAADKGTSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELAAEYESKVDPKQLDAIGNVLTRLDPGDSIVMTKSFSHMLILANLAEEVQIAYRRRIK
LKKGDFADENSATTESNFEETLKRLVGELKKSPHEVFDALKNQTIDLVLTAHPTQSVRRS
LLQKHGRIRSCLTKLYAKDITPDEKQELDEALKREIQAAFRTDEIRRAPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYAQIEDLMFELSMWRCSDELRVKADQLHRCAKKNTTKHYIEFWKQV
PPSEPYRVILSNVRDKLYNTRERARHLLASGFSEIPDEATFTDVEQFLEPLELCYRSLCA
CGDNSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITQYLGIGSYREWSEEK
RQEWLLSELNGKRPLFGPDLPQTDEIADALDTFHVIAELPYDSFGAYVISMATAPSDVLA
VELLQRECHVKKPLRVVPLFEKLADLEAAPAALARLFSVDWYRNRIDGKQEVMIGYSDSG
KDAGRFSAAWELYKAQEELIKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTSATLEHGMHPPISPKPEWRALMDEMAAVAT
KEYRSIVFQEARFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHVLQKDIRNLQILQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYD
KLLVSEDLWPFGARLRANYEETKQLLLQVAGHKDLLEGDPYLRQRLRIRDSYITALNVCQ
ACTLKRIRDPGFHVSPRAHLSKDIMDSGKPAAELVKLNTTSEYGPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggcgcgcaatgcggcggacaaggggacgtccatcgacgcgcagctgcggatcctggcg
cctaagaagctctcggaggacgacaagcttgtggagtacgacgcgctgctcctcgatcgc
ttcctcgacatcctccaggatctgcatggggaggacatcagggagacggttcaagaatgc
tatgaattagctgctgagtatgaaagtaaggttgaccccaaacagctggatgcaattggg
aatgtgttaactcgtttagatcctggagactccattgtgatgacgaagtcattctcacac
atgcttatcctggcaaacttggctgaggaggtccagattgcgtatcgtaggaggataaaa
ctgaagaagggtgattttgctgatgaaaactctgctacaactgaatcaaactttgaggag
accctaaaaaggcttgttggtgagcttaagaagtcccctcatgaggtatttgatgctctc
aagaatcaaacaatcgacctggtcctgacagcacatccaactcagtcagtcaggaggtcg
ctgctacaaaagcatggcaggataagaagttgtttaacaaaactttatgcaaaagacata
actccagatgagaagcaggaactcgatgaagcacttaagagagagatccaagccgccttt
agaacagatgaaattcggcgagcacctcctacaccacaggatgaaatgcgtgctggaatg
agttattttcatgagacaatatggaagggtgtacccaagtttttacgtagggttgatact
gcccttaagaacattggcataaacgagcgagtgccctataatgctcctcttattcaattt
tcttcttggatgggtggagaccgtgatggaaatccaagagtcacaccagaggttacaagg
gacgtatgcctgttagctagaatgatggctgctaacttatactatgcacagatagaggat
ctgatgtttgagctatctatgtggcgctgtagtgatgaactacgtgtaaaagctgatcag
ttacaccgttgcgcaaagaaaaacacaacaaagcactatatagagttctggaaacaagtt
cctccgagtgaaccctatcgtgtaatactgagcaatgtcagagataagttgtacaataca
cgcgagcgagcacgccatttattagccagtggattttctgaaattcctgacgaagcaaca
ttcactgatgttgagcagttcttggagcctcttgagctctgttacaggtctctctgtgcc
tgtggtgataattctattgcagatggcagtcttcttgactttctacggcaagtgtccaca
tttggactatcccttgttagacttgatattaggcaagaatctgaccgacatactgatgtt
atggatgccataactcaataccttggaattggatcctatcgtgaatggtcagaggagaaa
cgccaagaatggcttctgtcagaactcaatggaaagaggccattatttggtcctgacctt
ccccagacggatgaaattgctgatgccctagatacttttcatgtgatagcagaactaccc
tatgatagctttggtgcatatgtaatatccatggcaacagctccttcagatgttctagca
gttgagcttctgcaacgtgaatgtcatgtgaagaagccactgagagttgtgccattgttt
gaaaaactagcagatctggaagcagcaccagcagctcttgcccgacttttctctgttgac
tggtacagaaataggatcgacggaaagcaggaagtaatgattgggtattcagattctgga
aaagatgctggccgtttctctgcagcttgggaactgtataaagctcaagaggagcttatt
aaagttgctaagcagtttggggttaagttgactatgtttcatgggcgaggtggaactgtt
ggaagaggtgggggtcctacacaccttgctatactgtcacaacctccagataccattcat
ggatcacttcgtgtgactgttcaaggtgaagtcattgagcaatcttttggagaggagcat
ttgtgttttaggacacttcaacgttttacatctgctactcttgagcatggtatgcatcca
ccaatttcaccaaagccagaatggcgtgctttgatggatgaaatggccgctgttgctaca
aaagaataccggtccattgtcttccaagaggcacgatttgttgaatatttccgccttgca
acaccagagttggaatatggtaggatgaatattggaagtaggccatcaaaacgaaagcct
agtggaggcattgaatcacttcgtgcaattccttggatctttgcttggacacaaactcga
ttccacctaccagtgtggcttggttttggcgcagcgttcaagcatgtcttgcagaaggac
atacgcaatcttcagatccttcaggagatgtacaacgaatggccatttttcagggttaca
atagacttggttgagatggtgtttgctaagggtgatcctggtatagcagctctgtatgac
aagttgctagtttctgaggatttgtggccatttggtgctcgtcttagagcaaactatgaa
gaaacaaagcaacttcttctacaggttgctggacacaaagaccttctggagggagatcct
tacttgaggcagagactgcgtatccgtgattcctacatcacagcgctgaatgtttgccaa
gcttgcacgctaaagcgtatcagggaccctggcttccatgtaagcccccgagctcacctc
tccaaggacataatggactcagggaagccagccgctgagcttgtgaagctgaacacaaca
agcgagtacggcccaggcctcgaggacactctcatcctgaccatgaagggcatcgctgct
ggtatgcagaacactgggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325531
Entry
4325531           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4325531
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325531
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     4325531
SSDB
Motif
Pfam: PEPcase PEPcase_2 Scaffold
Other DBs
NCBI-GeneID: 4325531
NCBI-ProteinID: XP_015649289
UniProt: Q5QNA5 A0A0P0V025
LinkDB
Position
1:5899552..5909548
AA seq 1014 aa
MISLHSAPFTLLVKLPGRRRSGLTPPRCAVRGAGNVSSAAVREMAVAEGRRQHEYSIDAR
LRQLAPEKVSADDRLVDYETLLVARFLDILEDLHGGDFRQVVEDCLRLSGEYQSEGDPAR
LGELGGLLTSLDVGDAIMVASSFSHMLNLANLAEEIQMVYRKKAEASRRGDFVDEASAPT
ESDIDETFQRLVRGLGKSPREVFDALRSQTIDLVLTAHPTQSVRRSLLQKHASIRSCLTQ
LCGEGISDNEEQEIDEALQREILAAFKTDEIRRTPPTPQDEMRAGMSYFHDTIWNGVPKF
LRRVDTALKNIGIDERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANMY
FSKMADLMFELSMWRCNDELRARANELHRKSSRKYAKYYIEFWKKISPGEPYRIILGDVR
DKLYNTCERARQILSKGISSIPEDQTYTNVEQFLEPLELCYRSLCDCGDKLIADGRLLDL
MRQVSTFGLSLVKLDIRQESERHTDAMDAITTHLGIGSYREWPEERRQEWLVSELRGRRP
LFGPDLPQSEEVADVLGAFRVIAELPADSFGAYIISMATAPSDVLAVELLQRECGVKKPL
RVVPLFEKLADLQQARATMELLFSVDWYKERIDGKQEIMIGYSDSGKDAGRLSAAWQLYK
AQEEIVGVAERHGVKLTIFHGRGGTVGRGGGPSHLAILSQPPNTVNGSLRVTVQGEVIEK
SFGEENLCFRTLQRFTAATLEHGMNPPVSPKPEWRRLLDDMATVATDEYRSIVFQEPRFV
EYFRAATPETEYGRMNIGSRPSKRKPGGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFR
HAMQQSDAGGGLATLREMYDEWPFFRVTIDLLEMVFAKGDPGIAALYDELLVPDDLRPFG
EQLRANYVETQRLLLQVAGHKDLLESDPYLRQRLMLRDSYITALNVCQAYTLKRIRDGGF
RPETRPPLSKELLGSSAVAEKLVKLNPNSEYDPGLEDTLILTMKGIAAGMQNTG
NT seq 3045 nt   +upstreamnt  +downstreamnt
atgatctccctccactccgcccccttcaccctcctcgtaaagctccccggccggaggagg
agcggtcttacgccgccgaggtgcgccgtccggggagccgggaacgtgtcgtcggcggcg
gtgcgggagatggcggtcgcggaggggcggcggcagcatgagtactccatcgacgcacgc
ctccggcagctcgcgccggagaaggtgtccgccgacgaccgcctcgtcgactacgagacc
ctcctcgtcgcgcgcttcctcgacatcctcgaggacctccacggcggcgacttcagacaa
gtggtggaggattgcctgaggctgtccggggagtaccagagcgagggcgacccggcgagg
ctgggcgagctgggcggcctcctgacgagcctggacgtgggcgacgccatcatggtggcg
agctccttctcccacatgctcaacctggccaacctcgccgaggagatccagatggtgtac
cgcaagaaggcggaggcgagccggcgcggggacttcgtcgacgaggcctccgcgcccacc
gagtccgacatcgacgagacgttccagcgcctcgtccgcggccttggcaagtccccccgc
gaggtgttcgatgcgctccgcagccagaccatcgacctcgtcctcaccgcccaccccacg
cagtccgtcaggcgttcactcctccagaagcacgcaagcattaggagctgcctgacacag
ctctgcggcgagggcatctccgacaacgaggagcaggagatcgacgaggcccttcagaga
gagattctcgcggcgttcaagacggacgagatccggcggacgccgccgacgccgcaggac
gagatgcgcgccgggatgagctacttccacgacaccatctggaacggcgtgcccaagttc
ctccggcgcgtcgacacagcgctcaagaacatcggcatcgacgagcgcctcccctacaac
gcccccctcatccagttctcctcatggatgggcggcgatcgcgacgggaatccgagggtt
acaccagaggttaccagggacgtgtgcctgcttgccaggatgatggctgccaacatgtac
ttctccaagatggccgatttgatgttcgagctctccatgtggcgctgcaacgacgagctc
cgagctcgtgccaacgagttgcaccggaagtcctcaaggaagtacgccaaatactacatt
gagttttggaagaagatttctccaggagaaccttaccgcattatactcggcgatgtgagg
gacaagctgtacaacacctgcgagcgtgctcgccagatcttgtcgaagggaatttctagc
attcctgaagaccagacttacaccaatgtcgagcagttcttggagccgcttgagctgtgc
taccgatcgctgtgcgactgcggcgacaagctgatcgccgacggcagactgctcgactta
atgcggcaggtctccaccttcggcctctccctcgtcaagctcgacatccggcaggagtcg
gagcgccacaccgacgccatggacgcgatcaccacgcacctcggcatcggctcctaccgg
gagtggcccgaggagcggcgccaggagtggctcgtctccgagctccgcggcaggcgcccg
ctcttcggccccgacctgccgcagtccgaggaggtcgccgacgtgctcggcgcgttccgg
gtcatcgccgagctccccgccgacagcttcggcgcgtacattatctccatggccaccgcg
ccgtccgacgtgctcgccgtcgagctgctgcagcgggagtgcggcgtcaagaagcccctg
agggtcgtcccgctgttcgagaagctcgccgaccttcagcaggcgcgcgccaccatggag
ctcctcttctccgtcgactggtacaaggagcggatcgacgggaagcaggagatcatgatc
gggtactccgactccggcaaggacgccggccggctgtccgcggcgtggcagctgtacaag
gcccaggaggagatcgtcggcgtggcggagcggcacggcgtgaagctgaccatcttccac
ggccggggcggcaccgtggggcgcggcggcgggccgagccacctcgccatcctgtcccag
ccgccgaacaccgtcaatggctcgctccgcgtgactgtccagggcgaggtcatcgagaag
tcgttcggcgaggagaacctctgcttccggacgctgcagaggttcacggcggcgaccctg
gagcacggcatgaacccgccggtgtccccgaagcccgagtggcgccgcctgctcgacgac
atggcgacggtggccactgacgagtaccgctccatcgtgttccaggagccgcgcttcgtg
gagtacttccgcgccgccacgccggagacggagtacgggcggatgaacatcggcagccgg
ccgtcgaagcggaagcccggcggcggcatcgagtcgctgcgcgccatcccgtggatcttc
gcgtggacgcagacgcggttccacctccccgtgtggctgggcttcggcgccgcgttcagg
cacgccatgcagcagagcgacgccggcggcggcctcgccacgctccgcgagatgtacgac
gagtggcccttcttccgcgtcaccatcgacctcctcgagatggtcttcgccaagggcgac
cccggcatcgccgcactctacgacgagctcctcgtccccgacgacctacgtccattcggc
gagcagctcagagccaactacgtcgagacacagcgcctgctcctgcaagttgctgggcac
aaggatctcctggagagtgatccgtacctgaggcagcggctgatgctgcgggactcgtac
atcacggcgctgaacgtgtgccaggcgtacacgctgaagcggatccgggacggcgggttc
aggccggagacgcggccgccgctgtcgaaggagcttctgggctcgtcggcggtggcggag
aagctggtgaagctcaacccaaacagcgagtacgaccccgggctggaggacacgctcatc
ctcaccatgaagggcatcgccgccggcatgcagaacacgggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326138
Entry
4326138           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxylase 4
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4326138
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4326138
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     4326138
SSDB
Motif
Pfam: PEPcase PEPcase_2
Other DBs
NCBI-GeneID: 4326138
NCBI-ProteinID: XP_015629845
UniProt: A0A0P0UXD2 Q657S3
LinkDB
Position
1:complement(562114..572198)
AA seq 1035 aa
MTDTTDDIAEGISFQAFEDDCRLLGSLLHDVLLRELGPRFIHLLERITILAQSAVNMRSA
GVEDTAVVVEKQLGAELAAMSLEDSLCLARAFSHHLNLMTIADTYHRVRKARNFADLSKS
CDDTFAKLIQSGVSPEELYDTVCKQEVEIVLTAHPTQINRRTLQYKHLRIAHLLEFNERA
DLSLEDKEILIEDLVREITAIWQTDELRRHKPTPVDEARAGLHIVEQSLWKAIPHYLRRV
SNALKKNTGKPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTRDVSILSQWMAIDLYIRELD
TLSFELSINRCSEKLANLANDILLKESASEDQKTNTWNQTGPQNNLKLQHSLALPAQLPS
GADLPSCTECNDGESQIRMSKLPGNPKHKLALNITEKREDSPLPSPSHRPMGRTPSGGQL
RKMFTESQIGRSSFRKLLEPSISERPGSTPYRVVLGDVKEKLMNTRRRLELLLEDLPCDR
DTSEYYDTSDKLLEPLLLCYQSLQSCGSSVLADGRLADLIRRVATFGMVLMKLDVRQESG
RHTETLDAITSYLDLGVYSEWDEQKKLDFLTRELKGKRPLVPPYIQVTADVQEVLDTFRV
AAELGSDALGAYVISMASNASDVLAVELLQKDARLTVSGDLGRPCPGGTLRVVPLFETVN
DLREAGPAIRKLLSIDWYRDHIIKNHNGHQEVMVGYSDSGKDAGRFTAAWELYKAQEDVV
AACNAFGIKVTLFHGRGGSIGRGGGPTYLAIQSQPPGSVMGTLRSTEQGEMVQAKFGLPQ
TSVRQLEIYTTAVLLATLRPPQPPRDDKWRGVMEEISRVSCAQYRSTVYENPEFIKYFQE
ATPQAELGYLNIGSRPAKRRTTPGISNLRAIPWVFAWTQTRLVLPAWLGVGRGLQDACDK
GHTHELRAMYEEWPFFQSTVDLIEMVVAKADAPMAKHYDDVLVHDAGRRTLGAELRQELA
RTENCVLAVSGHKKLSANNRSLRKLIDSRLTYLNPMNMLQVEVLRRLRQDDDNRKLRDAL
LITINGIAAGMRNTG
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgacggacacgacggatgacatcgcggaggggatatcattccaggcgttcgaggacgac
tgccggctgctgggcagcctcctccacgacgtcctcctccgcgagctcggcccccgcttc
atccacctcctcgagcgcatcaccatcctcgcccagagcgccgtcaacatgcgctccgcc
ggggtggaggacaccgccgtcgtcgtcgagaagcagctcggcgccgagctggccgccatg
tcgctcgaggactcgctctgcctcgcccgcgccttctcccaccacctcaacctcatgacc
atcgccgacacttaccacagggttcgtaaagcacgcaatttcgccgacctgtcgaaatca
tgtgatgatacatttgccaaattgattcaaagtggtgttagcccggaagaactctatgac
actgtatgcaagcaggaggttgaaattgttctgacagctcatccaactcaaatcaatcgg
cggactttgcagtacaaacaccttagaatagctcaccttttggaattcaacgaacgtgct
gatcttagcctcgaggataaagaaattctaattgaagatctggtaagagaaatcacggca
atatggcagactgatgagttgaggcgccataaacctacacctgttgacgaagctagagct
ggccttcatattgttgagcaatcgctctggaaagcaataccacactatcttcgccgtgtt
agcaatgctctaaagaagaacactggcaagccacttccgctcacctgcacaccaatcaaa
ttcggttcatggatgggtggtgaccgtgatgggaatcctaatgtcacagcaaaagttact
agggatgtttccattttgtcccaatggatggcaattgatctgtacatccgggaactagac
actctaagctttgagctatcaattaacagatgcagcgagaagcttgcaaacttagcaaat
gacatcctgctcaaagaatcagcatcagaggaccagaagaccaatacctggaatcaaact
ggaccccagaacaatctaaagcttcagcacagcttggcccttcctgcacagcttccttct
ggtgctgatcttccatcatgtacagaatgcaacgatggggaatctcaaatcagaatgtca
aaacttccagggaatccaaagcataagttggctctaaacataacagaaaaacgtgaagac
agtccattgccgtctcctagtcatcgcccgatgggtcgaactccaagtggaggtcaacta
aggaagatgttcacagaatcccaaattggtcgatcgagcttccggaaacttctagaacca
agcatatcagagagaccagggagtactccttatagagttgtccttggtgatgtgaaagaa
aagctgatgaacacacggagacgactcgagcttcttcttgaggatctaccatgtgatcgt
gatacttcagaatattatgatacatcggataaacttttggagcccttgcttttgtgttat
caatcactgcaatcatgtggatctagtgtgcttgcggatggccggttagcagatttgatt
cgacgggttgcaacctttggtatggtgttaatgaagcttgatgtacggcaggaatcaggc
cggcatacggaaacacttgatgccatcacatcttacctggatcttggtgtttatagtgag
tgggatgaacaaaagaaactggatttcttgactagagagctgaaagggaagcgccctctt
gtccccccatacatacaggttactgctgatgtgcaagaagttcttgatacattccgtgtt
gctgcagagttaggaagcgatgcacttggagcatatgtgatttcaatggcctcaaatgca
agcgatgtcctagcggttgaactgttgcagaaggacgcaagacttacagtcagcggggac
ctaggaaggccatgtcctggtggaacgttgagagttgttccactgtttgagacggtgaat
gatctgcgagaagccggcccagcgatcagaaagttactgtccatcgactggtacagagac
cacatcatcaagaaccataacgggcaccaagaggtgatggtgggctactctgattccggc
aaggacgccggccgtttcaccgcggcatgggagctatacaaggctcaggaagatgtggtg
gccgcgtgcaacgcgttcggcatcaaggttacgctcttccatggccgcggcgggagcatc
ggccgcggcggcgggccgacctatctcgccattcagtcgcagccacccggctcagtgatg
ggaactcttcggtcgacggagcaaggggagatggtgcaggccaagttcgggctgccgcag
acgtctgtccggcagctggagatatacacgacggcggtgctgctggcgacgctgcggccg
ccgcagccgccgcgggacgacaagtggcggggggtgatggaggagatatcgcgggtgagc
tgcgcgcagtaccggagcacggtgtacgagaacccggagttcatcaagtacttccaggag
gcgacgccgcaggcggagctgggctacctcaacatcggcagccgccccgcgaagcgcagg
accacgccggggatctccaaccttcgcgccatcccctgggtgttcgcgtggacgcagacg
cggctggtgctcccggcgtggctcggcgtggggcgcggcctccaggacgcctgcgacaag
ggccacacccacgagctccgcgccatgtacgaggagtggcccttcttccagtccacggtg
gacctcatcgagatggtggtggccaaggcggacgcgcccatggccaagcactacgacgac
gtgctggtgcacgacgcggggcggcggacgctcggggcggagctccggcaggagctggcg
cggacggagaactgcgtgctggcggtgagcggtcacaagaagctgtccgccaacaaccgc
agcctgcggaagctgatcgacagcaggctcacgtacctcaaccccatgaacatgctccag
gtcgaggtcctccgtcgcctccgccaggacgacgacaaccgcaagctccgcgacgcgctg
ctcatcaccatcaacggcattgccgccggcatgcgcaacaccggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328859
Entry
4328859           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4328859
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4328859
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     4328859
SSDB
Motif
Pfam: PEPcase PEPcase_2
Other DBs
NCBI-GeneID: 4328859
NCBI-ProteinID: XP_015624648
UniProt: Q6EUD7 A0A0P0VH10
LinkDB
Position
2:complement(8177805..8184167)
AA seq 968 aa
MAAAAGKAAMERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREF
VQECYELSAEYENDRDEARLDELGRKLTSLPPGDSIVVSSSFSHMLNLANLAEEVQIAHR
RRIKLKRGDFADEASAPTESDIEETLKRLVTQLGKSREEVFDALKNQTVDLVFTAHPTQS
VRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEM
RAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTP
EVTRDVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHCSSRKAAKHYIEFW
KQIPPNEPYRVILGGVRDKLYYTRERTRHLLTTGVSEIPEEATFTNVEEFLEPLELCYRS
LCACGDKPIADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDAITTYLGIGSYAEWS
EEKRQDWLLSELRGKRPLFGPDLPQTEEIADVLGTFHVLAELPADCFGAYIISMATAPSD
VLAVELLQRECHIKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYMNRINGKQEVMIGYS
DSGKDAGRLSAAWQMYKAQEELVKVAKHYGVKLTMFHGRGGTVGRGGGPSHLAILSQPPD
TIHGSLRVTVQGEVIEHSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDEMAV
VATKEYRSIVFKEPRFVEYFRSATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWT
QTRFHLPVWLGFGGAFKHIMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDPGIAA
LYDKLLVAGDLQSFGEQLRNNFEETKQLLLQVAGHKDILEGDPYLKQRLRLRESYITTLN
VCQAYTLKRIRDPSFEVMSQPALSKEFVDSNQPAELVQLNAASEYAPGLEDTLILTMKGI
AAGMQNTG
NT seq 2907 nt   +upstreamnt  +downstreamnt
atggccgcggccgccgggaaggcggcgatggagcggcaccagtcgatcgacgcgcagctg
cggctgctcgcgccggggaaggtatccgaggacgacaagctcgtcgagtacgacgccctc
ctcgtcgaccgcttcctcgacatcctccaggacctgcacggccctcacctccgcgaattc
gtgcaggagtgctacgagctgtcggcggagtacgagaacgacagggacgaggcgcggctc
gacgagctggggaggaagctcaccagcctgccgccgggggactccatcgtcgtctccagc
tccttctcgcacatgctcaacctcgccaacctcgccgaggaggtgcagatcgcgcaccgc
cgccggatcaagctcaagcgcggggacttcgccgacgaggcctccgcgcccaccgagtcc
gacatcgaggagacgctcaagcgcctcgtcacccagctcggcaagtcgagggaggaggtg
ttcgatgcgctcaagaaccagaccgttgacctcgtgttcaccgcgcatccaacgcagtcc
gtcaggaggtccctgctccagaagcacgggaggatccggaattgcctgaggcagttatat
gcgaaagacatcactgctgatgacaagcaggagcttgatgaggccctgcagagggagatt
caagcagctttcagaactgatgaaatccgcaggactcctcccactcctcaggatgaaatg
cgcgccgggatgagttattttcatgaaactatatggaagggtgtaccaaagttcttgcgc
cgcattgatactgctctgaaaaatattgggattaatgagcgtcttccttacaatgctcct
ctcatccagttctcatcctggatgggtggtgaccgtgatggaaacccaagagttacacca
gaggttacaagagatgtatgcttgttggcaagaatgatggctgctaacctgtacttctct
cagatagaagatctgatgtttgagctctctatgtggcgctgcagtgatgaacttcgaatt
cgtgcagatgatttgcattgctcctccagaaaagctgcaaagcactatatagaattctgg
aagcaaattcctccaaatgagccttatcgtgtcatacttggtggtgtcagggataaattg
tactatacgcgtgaacgtactcgccatctattgacaactggagtttctgaaattccagag
gaggcaacgtttactaatgttgaagagtttctggagccgcttgagctgtgctacagatca
ttatgtgcttgtggtgacaaacctatagctgatggaagccttcttgatttcttgcgtcaa
gtatcaacttttgggctggctcttgtaaaacttgacataaggcaggagtctgatcgacac
actgatgtccttgatgccataactacatatcttgggattggatcttacgctgaatggtct
gaggagaaacgccaggattggcttttgtccgaactaaggggcaaacgtcctttgtttggt
cctgatcttcctcagactgaagaaattgctgatgttttaggaacatttcacgtccttgct
gagctcccggcagattgttttggtgcttacatcatctcaatggcaactgcaccatctgat
gtgcttgctgtggagcttctacagcgggagtgccatataaaacagcctctgcgagttgtt
cccctatttgagaaacttgcagatcttgaagcagctccagcagcggtggcacgactattt
tcaatagactggtacatgaataggattaatggcaagcaggaggtcatgattggatactca
gactctggcaaggatgctggtcgtctttctgcagcatggcaaatgtacaaagcacaagag
gagcttgtcaaggtggcaaagcattatggtgtaaagttgacaatgttccatggaagaggt
ggaacagttggcagaggaggtggtcccagtcatcttgccatattatctcaaccaccagac
acgatacatggatcacttcgtgtaacagtacagggcgaggttattgaacactcgtttgga
gaggaacacttgtgctttagaactctgcagcgctttactgcagctactcttgagcatgga
atgcatcctccaatttcccccaaaccagaatggcgtgctctaatggatgagatggctgtt
gtggcaacaaaggaatatcgatcaatcgtcttcaaggagccacggtttgttgaatacttc
cgatcggcaacacctgagacagaatatggcaggatgaacattggtagccgaccatcaaag
agaaagcctagtggtggcattgaatcgctccgtgcaattccttggatttttgcttggaca
caaactaggtttcatcttcctgtatggcttggatttggtggagcgttcaaacatataatg
cagaaggatatcaggaacatccatacactgaaagaaatgtacaatgagtggccattcttc
agggtcaccttggacttgcttgagatggttttcgccaagggagatccaggaattgctgct
ttatatgacaaattgcttgtggcaggtgatctgcaatcctttggagagcagctgagaaac
aactttgaagagacaaaacagctactccttcaggttgccggtcacaaggatattctggaa
ggggatccttacctgaagcagcgtctgcggctgcgtgagtcgtacatcactaccttgaac
gtttgccaagcctacaccctgaagcggataagggaccctagcttcgaggtgatgtcgcag
ccggccttgtcgaaggagttcgtcgacagcaaccagcctgccgagctggtccaactgaac
gctgcgagcgagtacgcacctggcctggaggacaccctcatcctgacgatgaagggcatt
gctgccggcatgcagaacacaggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345387
Entry
4345387           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4345387
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4345387
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     4345387
SSDB
Motif
Pfam: PEPcase PEPcase_2
Other DBs
NCBI-GeneID: 4345387
NCBI-ProteinID: XP_015650067
UniProt: Q0J655 Q8H4V1
LinkDB
Position
8:complement(16964826..16970572)
AA seq 964 aa
MAGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLRELVQECY
EIAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKL
KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSL
LQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMS
YFHETIWKGVPKFLRRLDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMASNLYCSQIEDLMFELSMWRCNDELRARADELHLSSKKDAKHYIEFWKKVPP
SEPYRVVLGDVRDKLYNTRERARQLLSSGYSDIPEETTLTSVEQFLEPLELCYRSLCDCG
DRVIADGTLLDFLRQVSTFGLCLVRLDIRQESDRHTDVLDAITTYLGIGSYREWSEERRQ
DWLLSELNGKRPLFGPDLPKTDEIADVLDTFRVIAELPADNFGAYIISMATAPSDVLAVE
LLQRECHVKTPLRVVPLFEKLADLESAPAAVARLFSIDWYRERINGKQEVMIGYSDSGKD
AGRLSAAWQLYKSQEELINVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPIAPKPEWRALLDEMAVVATKE
YRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGSAFKHILEKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDKL
LVSEELWPLGEKLRANCEETKQLLLQVAGHKDLLEGDLYLKQRLRLRNAYITTLNVCQAY
TMKRIRDPDYHVTLRPHMSKEIMDWSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggcggggaaggtggagaagatggcgtcgatcgacgcgcagctgcggatgctggcgccg
gcgaagctgtcggaggacgacaagctggtggagtacgacgccctcctcctcgaccgcttc
ctcgacatcctccaggacctccacggcgacgacctccgcgagctggtccaagaatgctat
gagatcgctgctgagtatgaagggaagcatgactcccaaaagctcgatgaacttggcaac
atgttgacaagcttggatcctggtgactccattgtgatggccaaagctttctcccacatg
cttaatttggctaacttggccgaggaggtccagattgcatacaggaggagaatcaagctc
aagaagggtgactttgctgatgagaactcggcactgacagaatctgacattgaagaaact
tttaagaggcttgttgttgacctgaagaaatcaccagcagaggtctttgatgcccttaag
agtcagactgttgacctggttttgactgcacatccaacacagtcagtgaggaggtcactg
cttcaaaaacactcaaggataaggaattgtttggttcaactatactcaaaggatatcaca
ccagatgataaacaggagcttgatgaggctctccagagggagattcaagcagcctttaga
actgatgagatccgaagaacccagccaactcctcaagatgaaatgagggctggtatgagt
tactttcatgagacaatctggaaaggtgttccgaagttcttacgccgtctggacactgcc
ttgaagaacatcggaattgatgagcgtgttccttataatgcacctctcattcagttctct
tcttggatgggaggagaccgtgatggaaatccaagagtgacaccagaagtcacaagggat
gtatgcttgcttgctagaatgatggcttcaaatttatactgctcgcaaattgaggatctc
atgtttgagctgtctatgtggcgatgcaatgatgagcttcgggcacgagcagatgagctg
catctctcctcaaagaaagatgcaaagcactatatagaattctggaagaaggttccgccc
agtgagccataccgagttgttctaggtgatgtgagagacaagctgtacaacacacgtgaa
cgagcacgccagttattatccagcggatattctgacattcctgaagaaaccactctcacc
agtgttgaacagttcttagagcctctggagctatgttacaggtcactctgcgattgcggt
gaccgtgtaattgctgatgggacccttctggacttcttgcgccaggtgtctacctttggg
ctgtgccttgtgaggcttgacattaggcaagaatctgacaggcacaccgatgtcctcgat
gccatcaccacatacctgggaataggatcataccgtgagtggtccgaggaacgccgtcag
gactggctcttgtctgaactcaatgggaagcgcccattgtttggcccagaccttcccaag
accgatgagattgctgacgttctagacacgttccgcgtgatagctgagcttcccgctgac
aattttggggcctatatcatttccatggcgacagctccgtcagacgtgcttgctgttgag
ctcctccaacgtgaatgccatgtgaagacaccacttagagttgtcccactgtttgagaag
ttggctgatcttgaatctgccccagcagcagtggccagactgttctccatagattggtac
agagaaaggataaatggcaaacaggaggtcatgattggctattcggactcgggtaaggac
gccggtcgtctctcggcagcttggcagctgtacaagtctcaggaggagctcatcaacgtt
gccaaggagtttggggtgaagttgacaatgttccatgggcgcggtgggactgtcggaaga
ggcggaggtcccactcatcttgccatcttgtctcagccaccagacacaatccatggatct
ctccgggtcactgtccagggtgaagtcattgagcagtcctttggtgaggagcacctttgc
ttcaggacactgcagcgtttcacggctgccactctggagcatggcatgcatccaccaatt
gcgccgaaaccagaatggcgtgctctgcttgatgagatggctgtggtggctacaaaggaa
taccggtccatcgtcttccaggaaccacgctttgtcgagtatttccgccttgcaacacca
gagatggagtatggaaggatgaatataggaagcaggccatccaagagaaagccgagtggt
ggcatcgagtcactccgtgccatcccatggatcttcgcgtggacgcaaactcgcttccac
cttcctgtctggcttggcttcggttctgccttcaagcacatcctggagaaggacatcagg
aacctccacatgctccaggagatgtacaatgagtggccgttcttcagagtcacgatcgat
ctggttgagatggttttcgccaagggtgaccctggcatcgccgcattgtacgacaagctc
cttgtctccgaggagctatggcctctgggagagaaactgagggccaactgtgaagaaacc
aaacagcttctccttcaggttgctggacacaaggatcttctcgaaggtgatctctacctg
aagcagcgccttcgcctccgcaatgcctacatcaccaccctgaatgtctgccaggcttac
acgatgaagcgaatccgcgacccggactaccatgtcacgctgcgcccccacatgtccaag
gagatcatggactggtctaagccggctgcggagctggtgaagctgaacccgaccagtgag
tatgcgccggggctggaggacaccctcatcctgaccatgaagggaattgctgctggaatg
cagaacaccggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346699
Entry
4346699           CDS       T01015                                 
Name
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00168  CAM (Crassulacean acid metabolism), dark
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4346699
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4346699
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     4346699
SSDB
Motif
Pfam: PEPcase PEPcase_2
Other DBs
NCBI-GeneID: 4346699
NCBI-ProteinID: XP_015611998
UniProt: A0A0P0XLG1
LinkDB
Position
9:complement(8692267..8697393)
AA seq 975 aa
MSAMSAAGGGGGVGKVERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHG
DDLKDLVQECYEVAAEYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEE
VQIAYRRRIKLKKGDFADENSAMTESDIEETLKRLVFDLKKSPAEVFDALKSQTVDLVLT
AHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQP
TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDG
NPRVTPEVTRDVCLLARMMAANLYCSQIEDLMFELSMWRCNEELRSRADDLHRSSKKDAK
HYIEFWKKVPLNEPYRVILSDVRDKLYNTRERSRELLSSGYCDIPEEATLTNVEQLLEPL
ELCYRSLCACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTYLGIG
SYREWSEERRQEWLLSELNGKRPLFGPDLPRTDEVADVLDTFHVIAELPADSFGAYVISM
ATAPSDVLAVELLQRECHVKTPLRVVPLFEKLADLESAPAALTRLFSISWYRQRINGKQE
VMIGYSDSGKDAGRLSAAWQMYKAQEQLVKVAKDFGVKLTMFHGRGGTVGRGGGPTHLAI
LSQPPDTINGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPSAPKPEWRAL
LDEMAVVATKEYRSVVFQEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIESLRAIP
WIFAWTQTRFHLPVWLGFGAAFKHALQKDIRNLHMLQEMYNEWPFFRVTLDLIEMVFAKG
NPGIAALYDKLLVSEDLQPLGEKLRANYVETQKLLLQVAGHRDLLEGDPYLKQRLRLRDA
YITTLNVCQAYTLKRIRDPDYHVTLRPHLSKEVMDGSKPAAELVKLNPGSEYAPGLEDTL
ILTMKGIAAGLQNTG
NT seq 2928 nt   +upstreamnt  +downstreamnt
atgtcggcgatgtcggcggcgggcggcggcggcggcgtggggaaggtggagcggctgtcg
tcgatcgacgcgcagctgcggcagctggtgccggcgaagctgtcggaggacgacaagctc
atcgagtacgacgcgctcctcctcgaccgattcctcgacgtcctccatggcctccacggc
gacgacctcaaggatctcgttcaagaatgctatgaggtggccgcggagtatgaaacaaag
cacgacgtgcaaaagctcgatgaactcggcaacatgataacaagcttggatccgggcgac
tcgattgttattgcgaaagccttttcgcacatgcttaacttggccaacttggctgaagaa
gtccagatcgcatacaggaggaggatcaagctcaagaagggtgatttcgctgacgaaaac
tcggcaatgactgaatccgacattgaggaaacactcaagaggcttgtttttgacctgaag
aaatcccctgctgaggtctttgatgccctcaagagtcagactgttgaccttgttttgact
gcacatccaacacagtctgtgaggaggtcactgctccagaaacactccaggattcggaac
tgtctggttcagctttattcaaaggatatcactccagatgacaagcaagagcttgatgag
gctctccagagagagatccaagctgcctttagaaccgatgagatccgaagaacacagccc
actccccaagatgaaatgcgtgctggcatgagctacttccatgaaacaatatggaagggt
gttccaaagttcttgcgccgtgtggatactgcattgaagaacatcggtatcgacgagcgt
gttccttacaatgctcctcttattcagttctcgtcttggatgggaggagatcgtgatgga
aatccaagagtcacaccagaggttacaagggatgtctgcttgcttgcaagaatgatggca
gcaaacttgtattgctcacaaattgaggatctcatgtttgagttatctatgtggcgatgt
aacgaggagctacgctcacgagctgatgatctgcaccgctcttctaagaaggacgcaaag
cattacatagagttttggaagaaggttcctctgaatgaaccataccgggtgatactgagt
gatgtgagagataagctttacaatacacgtgaacgatcacgggagttgttgtccagcgga
tattgcgacatccctgaggaagcaactctgacaaatgttgagcagctattggagcccttg
gagctatgctacaggtcgctgtgcgcctgtggtgaccgtgccatcgctgatggaagcctt
cttgatttcttgcgccaagtttccacctttggactctcccttgtgaggcttgacattagg
caagaatccgacagacacaccgatgtccttgatgccatcacgacatacctgggcatagga
tcttaccgtgagtggtccgaggaacgccgtcaagagtggctgttgtccgaactcaacggg
aagcgaccattgtttggcccagaccttcccaggacagatgaggttgctgatgttctagac
acattccatgtgattgccgagctccctgctgacagttttggagcctatgttatttccatg
gcaacagccccctcggatgtccttgctgttgagctcctccaacgcgagtgccatgtcaag
acaccgcttagagttgtccccctgttcgagaagttggctgatcttgagtctgcccctgcg
gcattgaccaggctcttctcaataagttggtacaggcagaggatcaatggtaagcaggag
gtcatgattgggtattcagattcaggcaaggatgctggccgtctctcggcagcttggcag
atgtacaaggctcaggagcagctcgtcaaggtagcgaaggatttcggggtcaagttgacg
atgttccatggacgaggtggaaccgttggtaggggcggtgggccgactcaccttgccatc
ttgtctcagcctccagacacgatcaacggatcgctccgtgtcactgttcagggtgaagtc
attgagcagagctttggtgaggagcacttgtgtttcaggacactgcagcgtttcaccgct
gctacacttgagcacggcatgcatccacccagtgcaccgaagccagaatggcgagctctt
cttgatgagatggctgtggtggcaaccaaggagtatcgatccgtagtgttccaagagcca
cgctttgtggagtatttccgccttgcaacacctgagacagagtatggaaggatgaacata
ggaagcaggccatccaagaggaagccgagtggaggcattgaatcactccgtgcgatccca
tggatcttcgcatggacgcagacccgcttccaccttcccgtctggcttggattcggtgct
gcattcaagcacgcccttcagaaggacatcaggaatctccacatgctccaggagatgtac
aacgagtggccgttcttcagggtcactctcgacctgattgagatggttttcgccaagggt
aatcctggcattgctgccctttacgacaaactcctcgtttctgaggatctacagccactg
ggtgagaagctgagagccaactatgtagagacacaaaagctgcttcttcaggttgctggc
catagggatcttcttgaaggtgacccctacctgaagcagcggctccgactccgcgacgcc
tacataaccaccctgaatgtctgccaagcctacacgctgaaacggatccgcgacccggat
taccacgtcacgctgcgccctcacctgtccaaggaggtgatggatgggagcaagccggcc
gcggagcttgtgaagctgaacccgggtagcgagtacgcgccagggctggaggacaccctc
atcctgaccatgaagggcattgctgcagggttgcagaacactggttaa

DBGET integrated database retrieval system