KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326552Help
Entry
4326552           CDS       T01015                                 

Definition
(RefSeq) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00169  CAM (Crassulacean acid metabolism), light
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4326552
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4326552
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4326552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic NDUF_B12
Motif
Other DBs
NCBI-GeneID: 4326552
NCBI-ProteinID: XP_015614053
UniProt: Q5JKW5
LinkDB All DBs
Position
1
AA seq 585 aa AA seqDB search
MAGRGEGNGAATMAGVATGGVEDAYGEDRATEDQPITPWAVCVASGHSLLRDPRHNKGLS
FTEKERDAHYLRGLLPPVVLSQELQEKRLLQNVRQFQVPLQRYMALMDLQERNERLFYKL
LIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGRILELLRNWPEKSIQVIV
VTDGERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITIDVGTNNEDLLKDEFYI
GLRQKRATGQEYSDLLDEFMAAIKQNYGQKVLVQFEDFANYNAFTLLEKYRANNLVFNDD
IQGTAAVVLAGLIAAQKFVSGTLADHTFLFFGAGEAGTGIAELVALEISNQSKVPVEDAR
KKIWLLDSKGLIVSSRKDSLQPFKKRYAHEHEPVKDLLDAVKVIKPTALIGSAGVGQSFT
KEVIEAMSSINERPIILALSNPTSQSECTAEQAYSWSKGRAIFGSGSPFDPVKYNDKLFV
PAQANNAYIFPGFGLGVVISGAIRVKDEMILAAAEGLADQVTPEHVDKGLIYPPFSCIRK
ISANIAARVAAKAYDLGLASHLPRPKDLVKYAESCMYSPIYRSYR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcgaggagaggggaacggcgctgcgacgatggcgggggtggccaccggtggc
gtggaggacgcctacggcgaggaccgcgccaccgaggaccagcccatcacgccgtgggcc
gtctgcgtcgccagcggtcactctctgctgagggatccacggcacaacaaggggctatca
ttcacggagaaagagcgagacgcccactacctgcggggtttgctgcctccagtcgtgctc
tcccaagaacttcaggagaagaggcttctgcaaaatgtgcggcagtttcaggttcctctg
caacgttacatggctctgatggaccttcaggagaggaatgagaggcttttctacaagctc
ctgatcgacaacgttgaggaattgctccccgttgtgtacacgccgacggtgggcgaggct
tgccagaagtacgggtcaatctttagacgaccacagggtctgtacatcagtcttaaagag
aaggggagaatattggagttactgaggaactggccagagaagagcattcaggttattgtt
gttactgatggtgagcgcattttaggtctcggggatcttggttgccagggtatgggaatc
cctgtgggaaagcttgcactatacacagcccttggaggtgtccggccttctgcttgctta
cctatcaccattgatgtgggaacaaacaatgaggatttactgaaggacgagttctacatt
ggattaagacaaaaacgagccactggccaggaatatagtgatcttctggatgaattcatg
gctgctattaagcagaactatggacagaaggtgctagtccagtttgaagacttcgcaaat
tacaatgcatttacccttcttgagaagtaccgtgcaaacaatcttgtcttcaatgatgat
attcagggaacggctgctgtagtgcttgcaggcctcattgctgctcagaaatttgtcagt
gggactttagctgatcacacattcttattctttggcgcaggagaggctggtacaggcatt
gctgaactagtggctctcgagatatcaaatcagtccaaagttccagtggaagatgctcgc
aaaaagatctggctacttgattcaaaggggttgattgtcagttcacgtaaagattctctt
cagccctttaagaagcgatatgcccatgagcatgaaccagtcaaagatctactggatgct
gttaaggttatcaaaccgactgcattgataggttcagctggtgtgggtcaaagtttcaca
aaagaggtgattgaggctatgagttcaattaatgagagaccaatcatcctcgcactatcc
aatccaacatcacaatctgaatgtactgctgaacaggcatattcatggagtaagggccgt
gcaatatttgggagtggaagtccatttgatccagttaaatacaatgacaagcttttcgtg
cctgcacaggcaaacaatgcatatatattcccaggatttggcctaggcgtagtgatttca
ggagcgataagggtgaaagatgaaatgatccttgctgctgctgaaggcttagctgaccag
gtgaccccagagcatgttgacaaaggccttatttatccacccttttcctgcatcaggaag
atatcagccaacatcgcagcccgcgttgctgcaaaagcctatgaccttggattggctagc
catctccctcgcccaaaagacttggtgaagtacgctgagagctgcatgtacagccccatt
taccgttcttatagatga

DBGET integrated database retrieval system