KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328326Help
Entry
4328326           CDS       T01015                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4328326
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4328326
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4328326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 4328326
NCBI-ProteinID: XP_015624320
UniProt: Q67IU5
LinkDB All DBs
Position
2
AA seq 234 aa AA seqDB search
MPMPLPSQVHRCHLLPAPPHSPSLVTLLYSPLLNLFTPPPATTTTLYSGDIMFINTASFV
AGAVVASPEQPAKLVRDQRRVVPGSCRARRGAASNGFRTYCMQTWNPFTNRRYEAMSYLP
PLSAKSISKEIEFIMSKGWVPCLEFDKEGEIHRSNSRMPGYYDGRYWTLWKLPMFGCSDA
AAVLREVEECRREYPDAFIRLIAFDSSRQCQCMSFVVHKPPSAAASPATVAGAE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgccattgccatcccaagtgcaccggtgccaccttctcccagcgccaccacac
tctccatctcttgtcaccttgctctactctccccttcttaacctcttcacgccaccgccg
gccaccaccaccactctctactccggcgacatcatgttcatcaacacggccagcttcgtc
gccggcgccgtcgtcgcttcgccggagcagccggccaagcttgtccgggatcagaggagg
gtggtgcctggctcctgcagggcaagaagaggtgcagcatccaatggcttcagaacttac
tgcatgcagacatggaaccctttcaccaacaggaggtacgaggcgatgtcttacctgcct
cccctgagcgcgaagtccatctccaaggagatcgagttcatcatgtccaaaggatgggtc
ccttgcctcgagtttgacaaggagggggagatccaccggagcaacagccggatgccgggg
tactacgacgggaggtactggacgctgtggaagctgccgatgttcggatgctctgacgcg
gcggcggtgctccgggaggtggaggaatgccggagggagtacccggacgccttcatccgc
ctcatcgccttcgacagcagccgccagtgccagtgcatgtccttcgtcgtccacaagccg
ccgtcggccgccgcttctccggccacggtcgccggagctgaatga

DBGET integrated database retrieval system