KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330380
Entry
4330380           CDS       T01015                                 
Name
(RefSeq) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4330380
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     4330380
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 4330380
NCBI-ProteinID: XP_015627599
UniProt: A0A0P0VN25 Q6ZGS9
LinkDB
Position
2:28362828..28366906
AA seq 443 aa
MASPSLRDAVGGLDRDPFVSLLGKLIGESRRLQNDPPALVPQEDLVAQHVVDALLPVSME
TGGGPLVVRKVSYAEGRSNVIVEYPGTVPGRAISFVGMHMDVVPANPDEWDFDPFSLTFD
SEDKDKLRGRGTTDCLGHVALVAQLMRRLGEVKPVLKHSVIAVFIANEENSLITGIGVDG
LVKDGLLDKLKNGPLFWIDTADKQPCIGTGGVITWHLKAIGKLFHSGLAHKAINAMELNM
EALKEIQTMFYNDFPPHEKEKLYKFATPSTIKPTKWSYPGGGLNQIPGECTISGDIRLTP
FYSTTSVVKKLQEYVHDINENIEKLPTRGPVSKYVLPDENLRGRLEITIDEDIMNGVACN
LESRGFQALCKATEEIVGHVEPYSITGSLPLIRELQDEGFDVQTAGYGLLKTYHAKNEYC
LFSDMAQGFQVFLSIISQLEADV
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggcatcgccgtcgctcagggacgccgtgggcggcctcgaccgcgaccccttcgtctcc
ctcctcgggaagctcatcggcgagtcccgccgcctgcagaacgacccgccggccctcgtc
ccgcaggaggacctcgtggcgcagcacgtggtcgacgcgctcctcccggtgtccatggag
accgggggcggcccgctcgtcgtgcggaaggtgagctacgccgagggccggagcaacgtc
atcgtcgagtaccccggcaccgtccccggccgcgccatctccttcgtcggcatgcacatg
gacgtcgtccccgccaaccccgacgaatgggatttcgatcccttctcactaacgtttgac
agtgaagacaaggacaaacttaggggccgtgggacaaccgactgccttggccatgtggcg
ctggttgctcagctcatgaggagacttggtgaggtcaagccggtgctgaaacattcggtc
attgcggtgttcattgccaatgaggaaaactcacttatcactggcattggtgtcgatggc
cttgtgaaggatgggttgctggataagctcaagaatggacccttgttttggatagatacg
gccgataagcagccttgcatcggcaccggtggagtgattacatggcatctgaaggcaatt
gggaagctattccacagtggcctcgcacataaggccataaatgccatggagttaaatatg
gaagcactgaaagaaatacagactatgttttacaacgatttccctccacatgagaaagag
aagctctataagtttgctaccccatctacgatcaaaccaacaaaatggagctatcctggt
gggggtctgaatcaaattcctggagaatgtacaatttcaggggatataaggttgactcct
ttctacagcacgacatctgtagtgaagaaattacaagagtatgtacatgatataaatgag
aacattgaaaagcttcctactcgtggtccggtatctaaatatgttcttcctgatgaaaac
ctccgaggaaggcttgagatcactattgatgaagatattatgaatggggtggcctgtaat
ctcgagtcgcgaggctttcaagcattatgcaaagcaactgaggaaattgtcggccacgtg
gaaccatattccattactgggagtctgcccctgattagggaattacaggatgaagggttt
gatgttcagactgctgggtatggcttactcaagacataccacgcaaagaacgagtactgt
ctattttcagatatggcccaaggctttcaagtatttctgagcatcatttcacagttggaa
gcagatgtttga

DBGET integrated database retrieval system