KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331059
Entry
4331059           CDS       T01015                                 
Name
(RefSeq) ribonucleoside-diphosphate reductase large subunit
  KO
K10807  ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4331059
   00240 Pyrimidine metabolism
    4331059
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4331059
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4331059
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     4331059
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    4331059
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Other DBs
NCBI-GeneID: 4331059
NCBI-ProteinID: XP_015627037
UniProt: Q6K848 A0A8J8Y8H2
LinkDB
Position
2:34327979..34333129
AA seq 810 aa
MYVVKRDGRQEAVHFDKITARLKRLSYGLSQEHCDPVLVAQKVCAGVYKGVTTSQLGELA
AETAAAMTASHPDYASLAARIAISNLHKTTMKSFSETIKVMYMHYDERSGLLAPLIADDV
YEIIMKNTTRLDSEIIYDRDFDYDYFGFKTLERSYLLKVVGKVVERPQHMLMRVSIGIHK
DDIESAIKTYHMMSQRWFTHASPTLFNAGTPRPQLSSCFLICMNDDSIEGIYDTLSECAT
ISKCAGGIGLSIHNIRATGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAIY
LEPWHADIFEFLDLRKNHGKEENRARDLFYALWIPDLFMERVQNNENWSLFCPNEAPGLA
DCWGDEFQNLYKKYEREGKAKKVVSAQALWFDILKAQIETGTPYMLYKDSCNRKSNQQNL
GTIKSSNLCTEIIEFTSPTETAVCNLASIGLPRFVREKGVPMESHPAKLVGSNGSKNRYF
DFDKLAEITSIVTRNLNKIIDTNYYPVETAKRSNMRHRPIGIGVQGLADTFILLGMPFDS
TEAQQLNKDIFETIYYHALKASAEIAAKEGPYETYSGSPVSKGILQPDMWNVVPSDRWNW
SDLREMISKVGVRNSLLIAPMPTASTSQILGNNECFEPYTSNIYSRRVLSGEFVVVNKHL
LHDLTEMGIWSPVLKNKIVYEDGSVQKISEIPDDLKAIYRTVWEIKQKTIVDMAIDRGCY
IDQSQSLNIHMDQPNFGKLTSLHFHAWSKGLKTGMYYLRTRAAADAIKFTVDTTLLKDKQ
HNAEEEDVQSKMAEVVCSLNNRDECLACGS
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgtacgtggtgaagcgcgatgggcggcaggaggcggtccacttcgacaagatcaccgcg
cggctcaagaggctcagctacggcctcagccaggagcactgcgatccggtcctcgtcgcg
cagaaggtctgcgccggcgtctacaagggcgtcaccaccagccagctcggcgagctcgcg
gcggagaccgccgccgccatgaccgcctcccaccccgactacgcctcgctcgccgcgagg
atcgcgatctcgaacctgcacaagaccaccatgaagtctttctcagagacgataaaggtc
atgtacatgcattacgatgagcgatctgggctgttggctcctctgattgccgatgacgtc
tatgagatcatcatgaagaataccacccgcttggacagtgagataatttatgacagagat
tttgactatgactactttggttttaagacccttgagagatcttatctgttaaaagttgtt
gggaaggttgtggaaagaccacagcatatgctaatgagagtttctattgggatacacaag
gatgatattgaatctgctatcaaaacgtaccacatgatgtctcagcgctggtttactcat
gcttcgccaacccttttcaatgctggcactccaaggcctcaattaagtagctgcttcctc
atctgcatgaacgatgatagcattgagggaatttatgatactctctcagaatgtgctacc
ataagcaaatgtgctggtggaattggtctctcaattcacaatattagagctactgggagt
tacattcgaggaacaaatggaacatctaatgggattgttcccatgctgcgtgttttcaat
gatactgcacgttatgttgatcaaggcggaggcaagagaaaaggtgcatttgctatatac
ttggagccttggcatgctgatatttttgagttccttgatttaagaaagaaccatggaaag
gaggagaatcgtgcaagagatcttttctatgcgctctggattccagatctgttcatggaa
agggtgcaaaataatgaaaactggtcattgttttgtcccaatgaagctccaggtttggct
gactgttggggagatgagtttcagaatctgtacaagaaatatgaaagagagggcaaggca
aagaaagttgtttcagcacaggcgctctggtttgacattttgaaggcacagatagaaact
ggaacaccatatatgctttataaggattcttgtaatagaaaaagtaaccaacaaaacctg
gggacaattaagtcttcaaacttgtgcacggagattattgagttcacaagtcccactgaa
actgctgtgtgcaatctagcatcgattggtttaccgcgttttgtaagggaaaagggtgtt
cctatggagtctcatccggctaagcttgttggtagtaatggatccaaaaaccgatatttt
gactttgataaattagctgagattacttcaattgtcacaaggaatctcaataaaataatt
gatactaattattaccctgttgagactgcaaagagatcaaatatgaggcacaggccaatc
ggaatcggtgttcagggcttggcagacaccttcattttacttggcatgccatttgattca
acagaggctcagcaattgaacaaggatatttttgagactatttattatcatgccttgaaa
gcttctgctgaaattgctgcaaaagaaggtccttatgaaacttatagcgggagccctgtc
agcaagggcattcttcaacctgatatgtggaatgtagttccatctgatagatggaattgg
tcagatttaagggagatgatttccaaagttggagttaggaactctcttcttattgctcca
atgcctaccgcttctactagtcaaattcttggcaacaacgaatgctttgaaccatacacc
tcaaacatatacagtcggagagttttaagtggcgagtttgttgtagtaaacaagcatctt
ctccatgatttgactgagatgggtatttggtcccctgttctgaaaaacaagattgtctat
gaagatggttctgttcaaaagatctctgagatcccagatgatctgaaagcaatttacaga
accgtgtgggaaatcaagcagaaaactattgttgacatggccatcgatcgtggttgttat
atcgatcagagccaaagtcttaatatccacatggaccaaccgaactttgggaagctaact
tccctgcacttccacgcttggtccaagggcctgaaaactggaatgtattatctaagaaca
cgcgctgctgccgatgcaatcaaattcacagtggacactactctcctcaaggataagcag
cataatgcagaggaagaggatgtccagtctaaaatggcagaggtggtgtgttccttgaac
aaccgggacgaatgcttggcatgtggtagttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340258
Entry
4340258           CDS       T01015                                 
Name
(RefSeq) ribonucleoside-diphosphate reductase large subunit
  KO
K10807  ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Module
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4340258
   00240 Pyrimidine metabolism
    4340258
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4340258
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340258
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     4340258
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    4340258
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Other DBs
NCBI-GeneID: 4340258
NCBI-ProteinID: XP_015641051
UniProt: A0A0P0WTF8
LinkDB
Position
6:complement(3449699..3454774)
AA seq 814 aa
MYVVKRDGRQETVHFDKITARLKKLSYGLSQEHCDPVLVAQKVCAGVYKGVTTSQLDELA
AETAAAMTASHPDYASLAARIAVSNLHKNTKKSFSETIKDMYGHFNERSGLNAPLVAHDV
YEVIMKNASRLDSEIIYDRDFDYDYFGFKTLERSYLLKLGGKVVERPQHMLMRVSVGIHK
DDIESAIKTYHLMSQRWFTHASPTLFNAGTPRPQLSSCFLICMKDDSIEGIYDTLKECAV
ISKSAGGIGVSVHNIRATGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAVY
LEPWHADIFEFLDLRKNHGKEEHRARDLFYALWVPDLFMQRVQNNQEWSLFCPNEAPGLA
DCWGDEFEKLYTKYEREGKAKKIVPAQTLWFDILKAQIETGTPYMLYKDTCNRKSNQQNL
GTIKSSNLCTEIIEYTSPTETAVCNLASIALPRFVREKGVPIESHPSKLVGSSDSKNRYF
DFDKLAEVTSTVTYNLNKIIDINYYPVETAKRSNMRHRPIGIGVQGLADTFILLGMPFDS
PEAQQLNKDIFETIYFHSLKASAELAGKEGPYETYEGSPVSKGILQPDMWNVVPSDRWNW
PSLRSTISKVGLRNSLLVAPMPTASTSQILGNNECFEPYTSNIYSRRVLSGEFVVVNKHL
LHDLTEMGVWTPALKNKIIYEDGSVQKMTVIPDDLKAIYKTVWEIKQKTLVDMAVDRGCY
IDQSQSLNVHMEQPNFGKLTSLHFHAWSKGLKTGMYYLRTRAAADAIKFTVDTALLKANG
ENGTKAAEEEDVEAKMAQMVCSLNNREECLACGS
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgtacgtggtgaagcgggacgggcggcaggagacggtgcacttcgacaagatcacggcg
cggctgaagaagctcagctacggcctcagccaggagcactgcgacccggtgctcgtcgcg
cagaaggtatgcgcgggtgtgtacaagggcgtcaccaccagccagctcgacgagctcgct
gccgagactgccgccgccatgaccgcgtcccaccccgactacgcctcgctcgcggcgagg
attgcggtttccaacctgcacaagaacaccaagaagtccttctcggagacgattaaggac
atgtatggacatttcaacgagagatctgggctgaatgctcctttggttgcccacgatgta
tatgaagtcatcatgaagaatgcttctcgcttggacagcgagataatttatgatagggac
ttcgattatgattattttggtttcaagactctggagaggtcttacctcctgaaacttggc
gggaaggttgttgaaaggccgcaacacatgttaatgagagtttcagtaggtatacacaag
gatgacattgagtctgctatcaagacctaccatctgatgtctcagcgctggtttactcat
gcttcaccgacccttttcaatgctggcactccaaggccccaattaagcagctgtttcctt
atctgcatgaaagatgacagcattgagggaatctatgatactttgaaggaatgtgctgtc
ataagcaaatctgctggaggaattggtgtatcagttcacaatattcgagctactgggagc
tatatccgtggaacaaatggaacctccaatgggattgttcctatgctacgtgttttcaat
gatactgcccgttatgttgatcaaggtggaggcaagagaaagggtgcatttgctgtgtac
ttggagccttggcatgcggatatttttgagttccttgatctgagaaagaatcatgggaag
gaggagcatcgtgcaagggatcttttctatgcactctgggttcctgatctattcatgcaa
agagtccaaaataaccaagaatggtcattgttttgtcccaatgaagctccagggttagct
gattgctggggtgatgagtttgagaaactgtacacaaaatatgagagagagggcaaggca
aagaaaattgtcccagctcagaccctctggtttgacattttaaaggcacagatagaaact
ggtacaccatatatgctttacaaggatacatgcaataggaaaagtaaccagcagaatttg
ggcacaattaaatcttcaaacttatgcactgagataattgagtacacaagccctactgaa
actgctgtctgcaatctggcatctattgctttaccacgttttgtaagggaaaagggtgtc
cccatagagtcccatccatctaaacttgtcgggagcagtgattctaaaaatagatatttt
gactttgacaagcttgctgaggttacttcaactgtcacatacaatctcaacaaaataatt
gatattaattattaccctgttgaaaccgcaaaaagatcaaatatgcggcacaggccaatt
ggcattggtgttcaagggttggcagatactttcatattacttggcatgccatttgattca
ccagaggctcagcaattgaataaggatatcttcgaaactatttactttcattctctgaaa
gcttccgctgagcttgctggtaaagaaggtccctatgaaacatatgaagggagccctgtc
agcaagggcattctccaacctgatatgtggaatgtagttccatctgacagatggaactgg
ccatctctacggagtactatttctaaagttggattaagaaactctcttcttgttgctcca
atgcctactgcttccactagtcagattcttggcaacaatgaatgctttgaaccttataca
tctaacatatacagccggcgggttctaagtggggagtttgttgtggttaacaagcatctt
ctccatgatttgactgaaatgggtgtttggactccagctctgaaaaataagataatttat
gaagatggttctgttcaaaagatgacagtgatcccagatgatctaaaagcaatttacaaa
acggtttgggagataaagcagaaaacgcttgttgacatggctgttgatcgtggatgctac
attgatcagagccagagtcttaatgttcacatggaacaaccaaactttgggaagctgact
tctctgcatttccatgcttggtccaagggcctgaaaactgggatgtattatctacgaaca
cgagcagctgctgacgcaatcaagttcacagttgatactgcccttttgaaggccaatgga
gaaaacggcaccaaggctgcagaggaagaggacgtggaagctaaaatggctcaaatggtt
tgttccttgaacaaccgggaggagtgcttggcgtgtggaagttag

DBGET integrated database retrieval system