KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331495
Entry
4331495           CDS       T01015                                 
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic
  KO
K05298  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) [EC:1.2.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4331495
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.13  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating)
     4331495
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N CP12
Other DBs
NCBI-GeneID: 4331495
NCBI-ProteinID: XP_015630808
UniProt: Q0DVH7 Q9SNK3
LinkDB
Position
3:1662177..1665491
AA seq 444 aa
MATHAALAASRIPATARLHSKAASKQRVDFADFSGLRPGSCSISHAAREASFSDVLGSQL
VARATGENAVRAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGGVRNASH
LLKYDSMLGTFKADVKIVDDQTISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVD
GPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNASCTTNCLAPFV
KILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP
QLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGILDVCDVPL
VSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAVQ
GSGDPLEDFCKDNPETDECKVYEN
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggccacacacgcagcgctcgcggcgtcccgcattccggccaccgcccggctgcacagc
aaggcggcgtccaagcagagggtggacttcgccgacttctccggactgaggccgggatcg
tgctccatcagccacgccgcgagggaggcgtccttctccgatgtccttggctcgcagctc
gtcgccagggctaccggagagaacgccgtgagggcgccggctgaggcgaagctcaaggtt
gccatcaacggcttcggccgcattggccgcaacttcctccggtgctggcacgaacgcgag
aactccccgctcgaggtcgtcgtcgtcaacgacagcggaggcgtcaggaacgcatcacac
cttctcaagtacgactcgatgctcggcaccttcaaggccgacgtcaagatcgtcgacgac
cagaccatcagcgtcgacggcaagctgatcaaggtcgtctccaacagggaccccctcaag
ctgccatgggctgagctcggcatcgacattgtcatcgagggtaccggagtgttcgtcgac
ggccccggcgccgggaagcacatccaggccggcgcgaagaaggtcatcatcactgctccg
gcgaagggtgctgacatccctacctacgtcctcggtgtcaacgagggagactactcccac
gaagtggccaacattatcagcaatgcttcctgcacaaccaactgcctcgctccgttcgtc
aagatcttggacgaagagttcggaatcgtaaagggaaccatgaccacaactcactcctac
accggcgaccagaggttgctggacgcgtcgcaccgtgacctgaggagggcccgggcggcg
gcgctgaacatcgtgccgacgagcaccggcgccgcgaaggccgtggcgctggtgctcccg
cagctgaaggggaagctcaacggcatcgcgctgcgcgtgccgaccccgaacgtgtccgtg
gtggacctggtgatcaacaccgtgaagaccggcatcaccgccgacgacgtgaacgccgcg
ttccgcaaggccgcggcggggccactcagcggcatcctcgacgtctgcgacgtgccgctg
gtgtccgtcgacttccgctgctccgacgtctcctccaccatcgacgcctcgctcaccatg
gtcatgggcgacgacatggtcaaggtggtcgcctggtacgacaacgagtggggctacagc
caacgcgtggtcgatctggcgcatctggtggcgagcaagtggcccggcgcggcggtgcag
ggcagcggcgacccactggaggacttctgcaaggacaacccggagaccgacgagtgcaaa
gtgtacgaaaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336044
Entry
4336044           CDS       T01015                                 
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
  KO
K05298  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) [EC:1.2.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4336044
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.13  glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating)
     4336044
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N RbcS
Other DBs
NCBI-GeneID: 4336044
NCBI-ProteinID: XP_015635988
UniProt: A3AUH9 Q7X8A1
LinkDB
Position
4:22937086..22939011
AA seq 402 aa
MASPMLSAATVPLQGGGLSEFSGLRSSSSLPLRRNATSDDFMNAVSFRTHAVGTSGGARR
APTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVIAINDTGGVKQASHLLKYDSTLGI
FDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKHIQA
GAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCTTNCLAPFVKILDQKFGIIKG
TMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALR
VPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELKGILEVCDVPLVSVDFRCSDVSCT
IDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcgtcgcccatgctctccgccgccaccgtgccactccagggaggcggcttgtcggag
ttctccggcctgaggagctcgtcgtcgctgccgctgcggcggaatgccacctccgacgac
ttcatgaacgcggtctccttcaggacccacgcggttggcacgagcggcggggcgcggcgg
gcgccgacggaggcgaagctgaaggtggcgatcaacgggttcggccgcatcgggcgcaac
ttcctgcggtgctggcacgggcgcggcgacagctcgcccctcgacgtcatcgccatcaac
gacaccggaggcgtgaagcaggcgtcgcacctcctcaagtacgactccacgctcggcatc
ttcgacgccgacgtcaagcccgtgggcgacaacgccatctccgtcgacggcaaggtgatc
aaggtcgtctccgaccgcaacccgtccaacctgccgtggggcgagctcggcatcgacctc
gtcatcgagggcaccggtgtgttcgtcgaccgcgacggcgcgggcaagcacatccaggcc
ggcgccaagaaggtgctcatcaccgcccccggcaagggtgacatccccacctacgtcgtc
ggcgtcaatgccgaccagtacagccccgacgagcccatcatcagcaacgcctcctgcacc
accaactgcctcgcccccttcgtgaagatcctcgaccagaagttcggcatcatcaagggg
acgatgaccaccacccactcctacaccggcgaccagaggctgctcgacgcgagccaccgt
gacctccggcgcgcgcgtgcggcggcgctgaacatcgtgccgacgtccaccggcgcggcc
aaggccgtggcgctggtgctcccgaacctcaaggggaagctcaacgggatcgcgctccgg
gtgccgacgccgaacgtgtccgtggtcgacctcgtggtgcaggtgtccaagaagaccctc
gccgaggaggtgaaccaggcgttccgcgacagcgccgccaacgagctcaagggcatcctc
gaggtctgcgacgtgccgctcgtgtccgtcgacttcaggtgctccgacgtgtcgtgcacc
atcgacgcgtcgctcagcatggtcatgggcgacgacatggtgaaggtcatcgcctggtac
gacaacgagtggggatactcgcagagggtcgtcgacctcgccgacatcgtcgccaaccag
tggaagtga

DBGET integrated database retrieval system