KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332184Help
Entry
4332184           CDS       T01015                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00410  beta-Alanine metabolism
osa00430  Taurine and hypotaurine metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4332184
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4332184
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4332184
   00430 Taurine and hypotaurine metabolism
    4332184
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     4332184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 4332184
NCBI-ProteinID: XP_015627912
UniProt: Q84U04
LinkDB All DBs
Position
3
AA seq 492 aa AA seqDB search
MVLSKAVSESDMSVHSTFASRYVRASLPRYRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFHAPLGEDETAVG
VGTVGSSEAIMLAGLAFKRRWQNKRKAEGKPFDKPNIITGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDMVNENTICVAAILGSTLNGEFEDVKLLNDLLDKKNKETGWETP
IHVDAASGGFIAPFLYPELEWDFRLPWVKSINVSGHKYGLVYAGIGWCIWRNKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQVIAQYYQLIRHGFEGYRNIMENCHENAMVLKEGLVK
TGRFDIVSKDEGVPLVAFSLKDRSRHDEFEISDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREEFSRTLAERLVLDIEKVMYQLDALPSRLMPPVPPAPLLVVAKKSELETQRSVTEAWK
KFVLAKRTNGVC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctccaaggccgtctccgagagtgacatgtccgtgcactccaccttcgcctcc
cgctacgtccgcgcctccctcccaaggtaccggatgccggagaactcgatcccgaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacggcaacccgcggctgaacctg
gcgtcgttcgtcaccacgtggatggagcccgagtgcgacaagctcatcatggccgccatc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgagctccagaaccggtgc
gtgaacatgatcgcgcacctgttccacgcgccgctcggggaggacgagacggcggtgggc
gtgggcacggtgggttcgtcggaggccatcatgctggccgggctggccttcaagcggcgg
tggcagaacaagcgcaaggccgaggggaagccgttcgacaagcccaacatcatcaccggc
gccaacgtgcaggtgtgctgggagaagttcgcccgctacttcgaggtggagctcaaggag
gtgaagctccgcgacggctactacgtcatggaccccgagaaggccgtcgacatggtcaac
gagaacaccatctgcgtcgccgccatcctcggctccaccctcaacggcgagttcgaggac
gtcaagctactcaacgacctcctcgacaagaagaacaaggagactgggtgggagacgccg
atccacgtggacgcggcgagcggcgggttcatcgcgccgttcctgtacccggagctggag
tgggacttccggctgccgtgggtgaagagcatcaacgtgagcggtcacaagtacgggctc
gtctacgccggcatcggctggtgcatctggcgcaacaaggaggacctgcccgaggagctc
atcttccacatcaactacctcggcaccgaccagccaaccttcaccctcaacttctccaag
ggctccagccaggtcatcgcccagtactaccagctcatccgccacggcttcgaggggtac
aggaacatcatggagaactgccacgagaacgcgatggtgctgaaggaagggctggtgaag
acggggaggttcgacatcgtgtccaaggacgaaggggtgccgctggtggcgttctcgctc
aaggaccggagccggcacgacgagttcgagatctccgacatgctgcgccgcttcggctgg
atcgtgccggcgtacaccatgccgcccgacgcccagcacgtcacggtgctccgcgtggtc
atccgggaggagttcagccgcaccctcgccgagcgcctcgtcctcgacatcgagaaggtg
atgtaccagctcgacgcgctcccctccaggctcatgccccccgtgccgccggcgccgctg
ctggtggtcgccaagaagtcggagctcgagacgcagcggtcggtgacggaggcgtggaag
aagttcgtgctcgccaagaggaccaacggcgtctgctag

DBGET integrated database retrieval system