KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332434
Entry
4332434           CDS       T01015                                 
Name
(RefSeq) arginine biosynthesis bifunctional protein ArgJ, chloroplastic
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4332434
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     4332434
    2.3.1.35  glutamate N-acetyltransferase
     4332434
SSDB
Motif
Pfam: ArgJ PhnG
Other DBs
NCBI-GeneID: 4332434
NCBI-ProteinID: XP_015630479
UniProt: Q10N79
LinkDB
Position
3:complement(9506731..9510932)
AA seq 463 aa
MPPPSLLLLHPRTPLPHHHRSSFRTSSPRPSRMVCAAAEGFISAAPILLPDGPWKQVEGG
VTAAKGFKAAGIYGGLRAKGEKPDLALVACDVDATVAGAFTTNVVAAAPVLYCKRVLNSS
KTARAVLINAGQANAATGDAGYQDTVDSADAVAKLLNVSTNDILIQSTGVIGQRIKKEAL
VNSLHRLVGSLSSSIEGANSAAVAITTTDLVSKSIAVQTEIGGVPIKIGGMAKGSGMIHP
NMATMLGVLTTDAQVSSDVWREMVRTSVSRSFNQITVDGDTSTNDCVIALASGLSGLSSI
LTHDSTEAQQFQACLDAVMQGLAKSIAWDGEGATCLIEVTVAGANNEAEAAKIARSVASS
SLVKAAVFGRDPNWGRIACSVGYSGIQFDADQLDISLGAIPLMKNGQPLPFDRSAASKYL
KDAGDIHGTVNIDVSVGRGGGSGKAWGCDLSYKYVEINAEYTT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgccgcccccttccctcctgctcctccatccacgcacgccgctgccgcaccaccaccgc
tcctccttccggacgagctctccgcggccatccaggatggtctgcgccgctgccgagggg
tttatctccgcggcgccgatcctcctccccgacggcccgtggaagcaggtggaaggcggc
gtcacggcggcgaaggggttcaaggcggcgggtatctacggcggtctgcgcgccaagggc
gagaagcccgaccttgcgctggtcgcctgcgacgtcgacgccactgtcgcgggagctttt
actacgaatgttgttgctgctgcaccagttttgtactgtaagcgtgtccttaattcatca
aaaacagctcgagctgtgttaattaatgctggacaagcaaatgcagcaacaggtgatgca
ggatatcaggatacagtggatagtgctgatgctgttgccaagcttcttaatgtgagcaca
aatgacatactgatccagtccactggtgttattggtcagagaataaagaaggaggcactt
gtaaattcacttcatagacttgtgggctcactgtcttcatccattgagggtgcaaattct
gcagctgtggccattacaactacagaccttgttagcaagagcatcgctgtacagacagag
attggaggagtgcctatcaaaataggaggaatggccaaaggttctgggatgattcatcca
aatatggcaacaatgcttggtgttttaacaactgacgctcaagtcagcagtgatgtttgg
agagaaatggtccgaacatcagtgagtagaagcttcaatcaaataacagtggatggtgat
acgagtaccaatgactgtgttattgctctggctagtgggttatctggtttatccagtatc
cttactcatgatagcactgaagctcaacagttccaagcatgcttagatgctgtaatgcaa
ggtcttgcaaaatccatagcatgggatggtgagggtgcaacatgtctaattgaggttact
gtagctggtgccaataatgaggctgaagcagctaaaattgctcgttcagtggcatcttcc
tccctggttaaagccgctgtatttggaagagacccaaactggggacgtattgcttgttct
gtcggttattcaggcattcagtttgatgcggaccagcttgatatttcccttggagctatt
ccactaatgaaaaatggtcaaccactcccatttgacagatctgcggccagcaagtatctg
aaagatgctggagacatccatggtacagtgaacattgatgtatcagttgggaggggagga
ggaagtggaaaggcctggggctgtgatttaagttataagtatgtcgagataaatgcggaa
tacacgacgtga

DBGET integrated database retrieval system