KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333177
Entry
4333177           CDS       T01015                                 
Name
(RefSeq) probable amino-acid acetyltransferase NAGS1, chloroplastic
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4333177
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     4333177
SSDB
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 KOW
Other DBs
NCBI-GeneID: 4333177
NCBI-ProteinID: XP_015631830
LinkDB
Position
3:complement(18087457..18094491)
AA seq 741 aa
MLINYGNIESSIAITGRRRTEKKPRASEKKSNTKSGTPRPKSRAYLKRPPSSLPRRDPRH
NPVVAALRAKSLVPPLALPPSLSLSVSLPLAFPAPLHSIPFSSRRVQITTTTATVLLQKA
RRPLLMAAAASLAAARFAGEASPAPAAAGAGTGTWRARCAGRVVAMPMRRQCARGVVVRC
AGAGAGRSFGGASCGGGGGGGGGAEDQEEEGTRFVGWFREAWPYVRGHRGSTFVVVVSGE
VVAGPHLDGILQDISLLHGLGIKFVLVPGTHVQIDKLLSERGKKAKYAGRYRITDSDSLE
AAMEAAGRIRLTIEAKLSPGPPMLNLRRHGVNGRWHEICDNVASGNFLGAKRRGVVGGID
YGFTGEVKKIDVSRIKERLDRDSIVVVSNMGYSSSGEVLNCNTYEVATACALAIEADKLI
CIVDGQIFDEHGRVNRFMSIEEADMLIRTRAKQSEIAANYVEVVGEEDISYARNLPIKEE
KELGLIGRDFVDGYTASFRNGVGFNNGNGLSGEQGFAIGGEERLSRSNGYLSELAAAAYV
CNGGVQRVHIIDGTVGGSLLLELFTRDGVGTMIARDMYEGTRMAREEDLSGIRKIIRPLE
ESGVLVRRTDKELLEALKSFIVVERDGSIIACAALFPFLEDKSGEVAAIAVSEECRGQGQ
GDKLLDYVEKKALSLGLEKIFLLTTRTADWFVRRGFKECSIESLPAQRRKRIDLSRGSKY
YIKRLRAAEIGQMAVNNFAVR
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgttgataaactacggcaatattgagtcatcaatagcgatcaccggaagaaggaggaca
gagaagaaaccgagagctagcgagaaaaagtccaacaccaaatccggcaccccccgacca
aaatcccgggcgtatttaaaacgccctccctcctcccttccccgccgcgacccacgccac
aaccccgtcgtcgctgcgctgcgcgccaaatcactcgttccaccgctcgctctccctccc
tctctctctctctctgtctctctccccctcgctttccccgctccgctccattccattcca
ttctcttctcgccgcgtacagattactactactactgctacagtactactacagaaggct
cgtcgaccccttttgatggcggcggcggcgtcgctcgccgccgcgcgattcgccggcgag
gcgtccccggcgccagctgcggcgggggcggggacggggacgtggcgggcgcggtgcgcc
gggagggtggtggcgatgccgatgcggcggcagtgcgccaggggcgtcgtcgtgcggtgc
gcaggggcgggggcggggcggtcgttcggtggggcctcctgcgggggcgggggcgggggc
gggggcggggcggaggatcaggaggaggaggggacgaggttcgtggggtggtttcgggag
gcctggccctacgtccgtggccaccgggggagcaccttcgtcgtcgtcgtctccggtgag
gtcgtcgccgggccccacctcgacggcattctccaggatatttcacttcttcatggtctt
gggatcaaatttgttcttgttcctggaacacatgttcagattgataagctcctatctgag
agagggaagaaggccaagtatgctggtcgttaccgtattactgattctgattcattagag
gctgcaatggaggcagcaggcagaatacgcttaactatagaagcaaaactatcccctggt
cccccaatgttgaatcttcgtcggcatggtgttaatggtcgttggcatgaaatatgtgat
aatgttgcaagtggaaactttcttggcgctaagagacggggggttgttggtggcattgat
tatggattcactggtgaagttaagaaaatagatgtttcacggataaaagaaagacttgat
agagatagcatagttgttgtgagcaatatgggatattccagctctggcgaggtgttgaat
tgcaacacatatgaagtcgctacagcttgtgctttagctatcgaggcagacaagcttatc
tgcattgttgatggtcaaatatttgatgaacatggtcgagtcaatcgtttcatgtctatt
gaagaagcggacatgttgatcagaacacgtgctaagcagagtgagattgctgcaaattat
gtcgaagttgtaggtgaggaggatattagttatgctcgcaatcttcctatcaaagaggag
aaagaattaggattgattggaagggacttcgttgatgggtatactgcatctttccggaat
ggtgtgggtttcaataacggaaatggtctgtctggtgagcaagggtttgcaattggtggg
gaagagcggttgagtaggtcaaatggttacctttcagagttagcagcagcagcatatgta
tgcaatggaggcgttcaaagggttcacattatagatggcactgttggcggatcattgttg
ttggaattattcacaagagatggtgttggaacgatgatagctagagacatgtatgaagga
acaaggatggctagagaagaagatctttctggtattagaaagatcatccgacccttagaa
gaatctggtgtcctagtgcggcgaacagataaagagcttctagaagcattgaagtcattt
atcgtcgtggaaagagatggttcaatcattgcatgtgctgctctctttccatttcttgag
gataaatctggggaagttgccgctattgctgtatctgaagaatgtcgaggacagggtcaa
ggggataagttacttgattacgtcgagaagaaggcattatcgcttggtcttgagaaaata
ttcttgctcaccacacgaacagcagactggtttgttcggcgtggcttcaaggagtgttcg
attgagtccctgcctgcgcagaggagaaaacgaatcgatctttcacgtggatcaaaatat
tacatcaagcggctccgggcagcagagattgggcagatggctgttaacaattttgctgtc
agatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343745
Entry
4343745           CDS       T01015                                 
Name
(RefSeq) probable amino-acid acetyltransferase NAGS2, chloroplastic
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4343745
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     4343745
SSDB
Motif
Pfam: Acetyltransf_1 AA_kinase Acetyltransf_7 Acetyltransf_10 KOW Acetyltransf_9
Other DBs
NCBI-GeneID: 4343745
NCBI-ProteinID: XP_015647050
LinkDB
Position
7:complement(23784680..23791414)
AA seq 591 aa
MASPSSVASARAAAEGAATVAARGGAEPARALRLPPANGARRGVRCCCGAANPGGGSGGG
GGAVAREEFVGFFREAWPYIRGHRGSTFVVVISSEVVSGPHFDGILQDISLLHGLGIQFV
LVPGTHVQIDKLLSERGRMAKYVGQYRVTDSDSLEAAMEAAGRIRLTIEAKLSPGPPMLN
LRRHGVIGRWHGLVDNVASGNFLGAKRRGVVSGIDYGFTGEVKKIDVSRIKERLDSDSIV
VVSNMGYSSSGEVLNCNTYEVATACALAIEADKLICIVDGQIFDEHGRVIPFMSLEEADM
LIRKRAKQSDIAANYVKVVDEEGISHLHEDVKPFLNGSGPLGAYAASFHNGLGFNNGNGI
LSGEQGFAIGGEERLSRSNAYLSELAAAAFVCHGGVQRVHIIDGTVDGSLLLELFTRDGT
GTMIARDVYEGTRIAREEDLLGIRKILRPLEESGVLVKRTDKELLEALESFYVVERDGSI
IGCAALFPFPEDKSGEVAAIAVSEECRGRGQGDKLLDYIEKAAMSLGLEKLFLLTTRTAD
WFVRRGFLECSIESIPEQRRKRINLSRGSKYYIKQLQPKHASVTPNNITAR
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcctcgccgtcgtcggtcgcctccgctcgcgccgccgccgaaggagcggcgacggtg
gctgctcggggtggcgccgagcccgcccgggccctgcggctgcctccggcgaacggggcg
cggcgcggtgtccggtgctgctgcggggccgcgaatcccggcggcggtagcggtggcggt
ggcggcgcggtcgcgcgggaggagttcgtcgggttcttcagggaggcgtggccgtacatc
cggggccacagggggagcaccttcgtggtcgtcatctccagcgaggtcgtgtcagggccg
cacttcgacggcattctgcaggatatttcacttcttcatggtttggggattcaatttgtt
cttgttcctggaacacatgtccaaattgataagctcttgtcagaaagagggaggatggct
aagtatgttggccagtaccgagttactgattctgattcattagaggctgcaatggaggca
gctggaagaatacgattaactattgaggccaagctttctcctggtcctccaatgttgaat
cttcgtagacatggtgttattggacgttggcatggtcttgtggataatgttgcaagtggc
aacttccttggtgctaagagaagaggagtagttagtggtattgattatgggttcaccggc
gaggttaagaaaattgatgtttcacgaataaaagaaaggcttgatagtgatagcatagtt
gttgtgagcaatatgggatactcgagctcaggagaagtgctaaactgcaacacttatgaa
gtagctactgcgtgtgctttagccattgaggcggataagctgatctgcattgtagatggc
cagatatttgatgagcatggacgtgtcattcctttcatgtctcttgaggaagcagatatg
ttgatcagaaagcgtgctaagcaaagtgatatcgcagcaaattatgtcaaggttgtggac
gaggagggtatcagtcatttgcatgaggatgtcaaaccatttttgaacggaagcggtcct
cttggtgcatatgctgcttctttccataatggcttgggtttcaacaatggaaatggtatt
ttatctggtgagcaaggatttgctattggtggtgaagagcggttaagtagatcaaatgcc
tatctttctgagttggcagcagcagcatttgtatgccatggtggtgttcaaagagttcat
atcatagatggaacagttgatggatcactgctattagaattgtttacaagagatggtaca
ggaacaatgatagctagggatgtgtatgaaggaacaaggatagctagagaggaggatctt
cttgggataagaaaaattcttcgaccactagaagaatctggtgttttggtgaagagaact
gataaggagcttcttgaagcactggagtcgttctatgttgttgaaagggatggttcaatc
attggatgtgctgctctgttcccatttcccgaagataaatctggagaagttgctgcgatt
gctgtatctgaagaatgccgaggaagaggtcaaggggacaagttgcttgactatattgag
aaggcagcaatgtcccttggtctggagaaattattcttgctcacgacacggacagctgat
tggtttgtgcggcgtggcttcttggagtgttcgattgaatccattcctgagcaaaggaga
aaacgcatcaatttatcacgaggatcaaagtattatataaagcagcttcagccaaagcac
gccagtgttactcccaacaatattactgccagatga

DBGET integrated database retrieval system