KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333458
Entry
4333458           CDS       T01015                                 
Name
(RefSeq) probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4333458
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     4333458
SSDB
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC NAD_binding_10 DapB_N NmrA Sacchrp_dh_NADP TrkA_N Epimerase DXP_reductoisom GFO_IDH_MocA
Other DBs
NCBI-GeneID: 4333458
NCBI-ProteinID: XP_015632676
UniProt: Q6AV34
Structure
LinkDB
Position
3:complement(23438218..23442293)
AA seq 415 aa
MGSTALGGGAPARLGLAPKDGVFGSNLKQCGGFMLKTTPKVGSSSVRVRASVASSPQKQH
SPKTSGVKSGEEVRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHL
ITQDLPNLVAVKDADFSNVDAVFCCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYA
EWYGHSHRAPELQQEAVYGLTEVLRNEIRNARLVANPGCYPTSIQLPLVPLIKAKLIKVS
NIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGIKGHRHVPEIEQGLSEAAESKVTISF
TPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGSSVPHTRHVVGSN
YCFMNVFEDRIPGRAIIISVIDNLVKGASGQAVQNLNLMMGLPENTGLQYQPLFP
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgggatcgacggcgctcggtggcggggctcctgctcgcctcggcttggcccccaaggat
ggagtctttggatctaatctgaagcaatgcggtggtttcatgctcaaaacaacccctaag
gttggatcctcttcagtccgtgtgagggcatctgttgcttcttcaccgcagaaacagcac
tctcccaagacatcaggagttaaatcaggggaggaggtgcgcattgcggttctaggtgcc
agcggttatactggagctgagattgtcaggcttctagcaaaccatcctcaatttcgtatc
aaagtgatgactgcagatagaaaagctggcgaacagtttggatctgtatttcctcactta
ataacacaggacctgccaaatttagttgcagtaaaagatgcagatttttcaaatgtggat
gcagttttttgttgcttgccacatggtacaacccaggaaattattaaaggtttaccgcag
gaactgaagattgttgatctctctgcagattttcgattgcgtgatatcaatgagtacgct
gagtggtatggccattctcatagggcaccagaacttcagcaagaagctgtgtatggcttg
actgaagttcttcgcaatgaaataaggaatgcacggcttgttgcaaatccgggatgttat
cccacatctattcaacttcctcttgttcctctaataaaggcaaaactgatcaaagtgagc
aacattatcattgatgcaaaatctggggttagtggggcaggacgtggagctaaggaagcc
aatctctacaccgagatagctgaaggcattcatgcttatggaataaaaggccaccggcat
gttcctgagattgaacaaggactttcagaggctgctgagtctaaagtcactatcagcttt
actccaaatctgatttgtatgaaacgtgggatgcaatctactatgttcgttgaaatggca
cctggagtgactgccaatgatttgtatcagcatctcaagtctacatatgagggtgaagaa
tttgtgaaactgttaaatggtagcagcgttcctcacacacgccatgttgtgggatcaaat
tactgcttcatgaatgtctttgaggacagaattcctggacgtgccatcatcatatctgtt
atagataatcttgtgaagggagcatcaggtcaggctgttcagaaccttaatctgatgatg
ggtctgccagagaacactgggctgcaatatcaacccctatttccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348992
Entry
4348992           CDS       T01015                                 
Name
(RefSeq) probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4348992
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     4348992
SSDB
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC NmrA NAD_binding_10 DapB_N TrkA_N Sacchrp_dh_NADP Epimerase DXP_reductoisom GFO_IDH_MocA
Other DBs
NCBI-GeneID: 4348992
NCBI-ProteinID: XP_015613574
LinkDB
Position
10:18773343..18777845
AA seq 412 aa
MGWSTALGGGAAAPAPKKGVCGLNLKSCSGFMLKTTPKVGCPSLRVRASVSSPQKLYSSK
TTQVKSGEEVQIAVLGASGYTGAEIVRLLANHPQFHIKVMTADRKASEQFGSVFPHLITQ
DLPNLVAIKDADFSNVDAVFCCLPHGTTQEIIKGLPKQLKIVDLSADFRLRDINEYAEWY
GHAHRAPELQQEAVYGLTEVLRDEIRNARLVANPGCYPTSIQLPLVPLIKAKLIKLSNII
IDAKSGVCGAGRGAKEANLYTEIAEGIHAYGIKGHRHAPEIEQGLSEAAKSKVTISFTPN
LICMKRGMQSTMFVEMAPGVTAGDLYQHLKSTYEGEEFVKLLHGSTVPHTRHVVGSNYCF
MNVFEDRIPGRAIIISVIDNLVKGASGQAVQNLNLMMGLPENRGLQYQPLFP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggggtggtcgacggcgctcggtggcggcgccgcggctccggcccccaagaagggagtc
tgtgggcttaatttgaagtcatgcagtggtttcatgctcaaaacgactccaaaggtcgga
tgcccttcgctccgtgtgagggcatctgtctcttcaccacagaaactatactcttctaag
acaacacaagttaaatcaggggaggaggtgcagattgcggttctaggggccagtggttat
actggagctgagattgttcggcttctggcaaaccaccctcagtttcatatcaaagtgatg
accgcagatagaaaagctagcgaacagttcggatctgtatttcctcatttgataacgcag
gacctcccaaatttagttgcaataaaagatgcagatttttcaaatgttgatgcggttttt
tgttgcttgccacatggaacaacccaggaaattattaaaggtttaccgaagcaactgaag
attgttgatctttctgcggatttccgtttgcgtgatatcaatgagtacgctgagtggtat
ggtcatgcacatagggcaccagaacttcagcaagaggctgtgtatggtttaactgaagtt
cttcgagatgaaataagaaatgcacgacttgttgcaaatccaggatgttatcccacatct
attcagcttcctcttgttcctctgataaaggcaaaactgatcaagctgagcaacattatc
attgatgcaaaatctggggtttgtggagcaggacgtggagcgaaggaggcgaatctttac
actgagatagctgaaggcatccatgcttatggaataaaaggccaccgtcatgctcccgag
attgaacaaggactttcagaggctgctaaatctaaagtcactatcagttttactccaaat
ctgatctgtatgaaacgtggaatgcaatctaccatgtttgttgaaatggcacctggagtg
actgccggtgatttgtaccagcatctcaagtctacttatgagggcgaagagtttgtcaag
cttttacatggcagcactgttcctcacacgcgccatgtcgtgggatcaaattactgcttc
atgaatgtcttcgaggacaggattcctggaagggccatcatcatctctgttatagataat
cttgtgaagggagcgtctggtcaggctgtccagaacctcaatctgatgatgggcctgcct
gagaacagagggctgcaatatcagcccctatttccatga

DBGET integrated database retrieval system