KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334626Help
Entry
4334626           CDS       T01015                                 

Definition
(RefSeq) dolichol-phosphate mannosyltransferase subunit 1
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4334626
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4334626
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     4334626
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   4334626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 4334626
NCBI-ProteinID: XP_015633051
UniProt: Q10BB4
LinkDB All DBs
Position
3
AA seq 243 aa AA seqDB search
MADDAGGGRREYSIIVPTYNERLNVALIVYLIFKHLPDVNFEIIVVDDGSPDGTQDIVKQ
LQQIYGENRVLLRARPRKLGLGTAYLHGLKHASGDFVVIMDADLSHHPKYLPSFIRKQKE
TGADVVTGTRYVQNGGVHGWNLMRKLTSRGANVLAQTLLQPGASDLTGSFRLYKRNVLED
LISSCVSKGYVFQMEMIVRATRKGYHIEEVPITFVDRVFGTSKLGGSEIVEYLKGLVYLL
LTT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgacgcgggcggcggcaggcgcgagtacagcatcatcgtgcccacctacaac
gagcgcctcaacgtcgccctcatcgtctacctcatcttcaagcacctgccggatgtcaac
tttgaaatcatagttgtggatgatggaagccctgatggaactcaagacattgtaaagcag
ttgcagcaaatatatggtgaaaaccgtgttctgctgcgagctagaccgaggaagctagga
cttggtactgcatatttacatggactaaagcatgcctctggggacttcgttgttatcatg
gatgctgacctatctcaccatccgaagtacttgccaagcttcattaggaagcaaaaggaa
actggtgctgatgttgtaactggcacccgttatgttcagaacggtggtgtccatggttgg
aatctcatgcgcaagttgactagcaggggagcaaatgttctagcacaaacattactacag
cctggagcttctgatttgactggatcattcaggctatataaacggaatgtcctagaagat
ttaatctcctcgtgtgtcagcaagggatatgttttccaaatggaaatgattgttagggct
accaggaaaggttatcacattgaagaggttccaataacttttgtcgatagggtttttgga
acttcaaaacttggtggatctgagatagttgagtatctgaaaggccttgtttatctgctg
ctcactacatag

DBGET integrated database retrieval system