KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334928Help
Entry
4334928           CDS       T01015                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3D isoform X1
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4334928
   03036 Chromosome and associated proteins [BR:osa03036]
    4334928
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     4334928
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    4334928
   PBAF complex
    4334928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM SWIRM-assoc_1 Myb_DNA-binding ZZ Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 4334928
NCBI-ProteinID: XP_015633469
UniProt: Q7XSW0
LinkDB All DBs
Position
4
AA seq 886 aa AA seqDB search
MEPNPPPPPAAATATYRRRGKPKPKPKRKAAKPPSPSPPPKRQARDDPPHTGPLTRHSPL
NPAPEDAPPQLHAGERDPPPRAWIEPAKLPPVSEEVQAVLSRGAGVHVVPSFAGWFSWKE
IHQIEKQALPSFFDGISLRRTPEIYLGIRNFIMKKFHSNPQMHLELKDLSELSDGEMDAQ
LKVLEFLSHWGLINFHPFPPAVQGVSELVESITNADTEEKISVVDKLFQFETLQSYLIPA
PNQAEVTAPIHTPSLLSEPTLTEDSITQAESSVEYHCNSCSVDCSRKRYHCRTQADFDLC
CDCYDKGNLDAGMSQTDFIIMESAEIPGFGGTSWTDQETLLLLEALEIFQAKWGDIAEHV
ATKSKAQCMLHFLKMPIMDPFLHDGDVNEISQETAEQVSAEQGTSRVTEKMEVEDKTKEI
KTNDRKTAAKPKLNLTETEVNLDDNVVANNDTKSSGDINVDVCSNTGVSNRSSDTEPTKK
ETSGENTSNIVNDVLKYAFEAVGHIPKIEGLGSFTEAGNPVMALVAFLSGLVDHDDVTTL
CCSSLKAISDMSPALQLATMHCFILQDPPNDLKDPPVSISFANTDCGQQKDKDATSNPSV
TDNDDNLKEESALSVEEPNTTSTSSKNTRKLSNAKESKDESPQVEPKPSSANDCDNPISQ
VAKRASDNIRGHSSTVLPVSLNNTNEPCSISSQEASAGNTKDTSHTEHIEGDKPIYEDPP
LEGKVELNKIEHEVTDLSAVQQHESIQTSLKKGYIQDHNSIKKTVADDVSVQRLQRAAAS
AISAAAVKSKLLAKHEEYQIQRLAALVIDKQLHKMQAKMSVFTEADNLVLRAREHTERTR
KKLLMERSAIIASRMAALPPRPNHQPGMPGSRLPVGYGVNQHLRRS
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaatcccccgccgccgcccgccgccgccaccgcaacctaccgccgccgcggc
aagcccaagcccaaacccaagcgcaaggcagccaagcccccctcgccgtccccgccgccc
aagcgccaggcccgggacgaccccccgcacacggggccactcacccgccactcgccgctc
aaccctgcgccggaggatgcaccgccccagctccacgccggggagcgcgacccgcctccg
cgcgcctggatagagcccgcaaagcttccgccggtgagcgaggaagtccaggccgtcctg
tcgcgcggagccggcgtccacgtcgtcccctccttcgcaggatggttttcatggaaggaa
atccaccaaattgaaaagcaagcattgccttcgttttttgatgggatatctttacggagg
acacctgagatatatttgggaattagaaattttattatgaagaaatttcattctaatcct
caaatgcatttggagttgaaggatttgtctgagttgtcagatggggagatggatgctcag
ttgaaagtcttggagttcttgtcacactggggtttgatcaatttccacccttttccacca
gctgtacagggggtgagtgagctggttgagagcataacaaatgctgatacagaagagaaa
atttctgtagtggataaattatttcagtttgaaacattgcagtcatatctcattcctgct
cctaaccaagcagaggtgacagctccgattcacaccccgagcttgctttctgagcctact
ctaactgaagattcgattacccaagctgagtcttctgttgagtaccactgcaactcttgc
tcagttgattgctcaaggaagcgctaccattgcagaactcaggcagactttgacttgtgt
tgtgactgttatgacaaaggaaatttggatgcaggcatgtcacaaactgatttcatcatt
atggaatctgcagaaattccaggctttggtggtactagctggactgaccaggagaccttg
cttcttttggaagctttagaaattttccaagcaaaatggggtgacattgccgagcatgtt
gctacaaaaagcaaagcacaatgcatgctacacttccttaaaatgccaattatggaccca
tttctgcatgatggagatgttaatgaaatatctcaggaaactgcagagcaggtctcagca
gaacaaggtacttctcgtgtaactgagaaaatggaagtagaagacaaaacaaaagaaata
aaaactaatgatagaaaaactgctgcaaaaccaaaattgaacttgacagaaacagaagta
aacctagacgacaatgttgttgcaaataatgataccaagagttcaggtgatatcaatgtg
gatgtatgtagcaatactggtgtatcaaatagatcttcagataccgaacctacaaagaag
gaaacttctggggaaaacacatcaaacattgttaatgatgtcctgaaatatgcttttgag
gctgttggtcacattccaaagatagagggcttgggttcatttactgaagcaggaaatcct
gtcatggcactggtggcatttctatctggccttgtggatcatgacgatgttactacgttg
tgctgtagttcactgaaagctatatctgatatgtctcctgctcttcaactggcaacaatg
cattgttttattcttcaggatccaccaaatgacctcaaagatccaccggtcagtataagc
tttgcaaacacagattgtgggcaacaaaaagacaaggatgctacttcaaatccaagtgtt
actgacaatgatgacaatttaaaagaagagtctgctttatctgtggaagagccaaatacc
acatccacatcatcgaaaaacaccaggaaattatctaatgcgaaggaatctaaggatgaa
tctccccaagtggagcccaaacccagtagtgccaacgattgtgacaatccaatttctcag
gtggcaaagagggcttctgataatataagaggacacagttccactgtgcttcctgtcagt
ctgaataatacaaatgaaccttgttccatatcttcccaagaggctagtgcaggaaacaca
aaggatacaagtcatacagaacacatagaaggagataaaccaatttatgaggatccacca
ttagaaggaaaggtagagttgaacaagatcgaacatgaagtcactgacttatctgctgta
cagcaacatgagtccatccaaacaagtttgaagaagggctacatacaagatcataacagt
attaagaaaacagttgccgatgatgtctccgtacaaaggctacagcgggcagcagccagt
gctatttcagcagctgctgtgaagtcgaaactccttgcaaagcatgaggaatatcaaatc
cagcgactagctgcacttgtgattgataaacagctccacaagatgcaagcgaaaatgtca
gttttcactgaagcagataatttggtcctgcgagcgagagaacacaccgagagaactcgg
aagaagcttctgatggagaggagcgcgataatcgcttctcggatggcggcattgccaccc
agaccaaaccaccaacctgggatgcctgggagcagattgccggtagggtatggtgtgaat
cagcatctgaggcgatcttga

DBGET integrated database retrieval system