KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335210Help
Entry
4335210           CDS       T01015                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4335210
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     4335210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 Pyr_redox GIDA Lycopene_cycl NAD_binding_8 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 4335210
NCBI-ProteinID: XP_015637157
UniProt: Q7XSW7
LinkDB All DBs
Position
4
AA seq 629 aa AA seqDB search
MATWRLRRAAAAIAASSAVVAAGAAWPSASASDPSPAALEAARRRVAQPGAAPPPRAAQR
AALAGSTPADPLDVLVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGG
VRYLEKAVFNLDYGQLKLVFHALKERKQVIENAPHLCHALPCMTPCFNWFEVVYYWFGLK
FYDIVAGRRLLHLSRYYSVDESVELFPTLAKNSHDRSLRGTVVYYDGQMNDSRLNVGLAC
TAAVVGAAILNYAEVVSLIKDESGERIIGARIRDTLSGKEFDAFAKVVVNAAGPFCDSVR
KMANNDVVPMISPSSGVHIVLPDYYSPDGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSS
TAITMLPEPHEDEIQFILDAICDYLNVQVRRSDVLSAWSGIRPLAMDPSAKNTESISRDH
VVFEDYPGLITITGGKWTTYRSMAEDAVNAAIRSGNLKPANGCVTDHLHILGGYGWDPAS
FTVLAQNYKRMKRTYGGKIIPGAMDSAVSKHLSHAYGTLATQVASIAQNEGLGKRLAHGY
PFLEAEVAYCARHEYCESAVDFIARRCRLAFLDTDAAGRALPRIIEILALERKWDKARQK
LELQKGKDFLETFKSSKNAQFRDGKHNGQ
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtggcgcctccgccgcgcggccgccgccatcgccgcgtcctccgccgtcgtc
gccgcgggcgcggcctggccgtccgcgtccgcttccgacccgtcccccgcggccctcgag
gccgcgcggcggcgcgtggcccagccgggcgcggccccgccgccacgcgccgcgcagagg
gcggcgctggccgggtccacccccgcggatcccctcgacgtgctcgtcgtcggcggcggg
gccaccgggtgcggcgtcgcgctcgatgccgcaacccgcgggctccgcgtcggcctcgtg
gagcgcgaggacttctcctctgggacatcctcccgatccaccaaactcatccatggcggt
gtgcgctatttggagaaggcagtattcaatcttgattatgggcagctgaaactcgttttt
catgctttgaaagaaagaaagcaggttattgaaaatgctccccacttatgccatgctttg
ccatgcatgactccttgctttaattggtttgaggttgtatactattggttcggcctgaaa
ttctatgatatcgttgctggaagaaggctgctacatttgtcacgatattattctgtagat
gaatcagttgaacttttcccaacccttgcaaaaaacagccatgatcgtagcctaagaggg
acagtggtatactatgacggtcaaatgaatgacagtcggctgaatgtgggcttggcatgc
actgcagcggttgttggtgcagctattcttaattatgctgaagtggtatccctcattaag
gatgaatctggagaaaggattattggtgcacggatccgtgatacgctatcaggtaaagaa
ttcgatgcatttgcaaaggtggttgttaacgcagcaggaccgttctgtgactctgtgagg
aagatggctaacaatgacgtagtgcccatgatcagtccaagcagtggagtgcacattgta
cttcctgattattattcccctgatgggatggggctaattgtccctaaaaccaaggatggt
agagttgtatttatgctgccatggttaggaaggacagtagctggtacaaccgactctagt
acagcaataacaatgcttcctgaaccacatgaggatgagatacagttcatattagatgct
atctgtgattatcttaacgttcaggtaaggcgttcagatgttctttctgcctggagtggt
atacgtccactggctatggatccatcggcaaaaaatactgagagcatttccagagatcat
gttgtatttgaagactacccaggactaataactatcactggtggaaaatggacaacttat
agaagcatggctgaagatgctgttaatgcagccataaggtcaggtaatttgaagcctgcc
aatggctgtgtgactgatcatctgcatattcttggtggatatggttgggatcctgcttcg
tttactgtccttgcacagaactataaacggatgaaaaggacatatggtgggaagatcatt
ccaggtgcaatggacagtgctgtatcgaagcatctgtcacatgcatatggaactttggct
acacaagtggcttcaattgcccagaatgaaggcttggggaagcgacttgctcatggatac
ccatttttggaggctgaagtagcatactgtgctcgccacgagtactgtgaatctgctgtg
gacttcattgcaaggagatgccgtcttgcatttcttgacacagatgctgctgggagagca
ttgcctcggatcatcgagattttagctctggaacgcaagtgggacaaggcaaggcagaag
cttgaactacaaaagggtaaagatttcctggaaacattcaagtcatccaagaatgcacaa
ttcagggatggcaaacataatggtcaatga

DBGET integrated database retrieval system