KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340725Help
Entry
4340725           CDS       T01015                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340725
   00053 Ascorbate and aldarate metabolism
    4340725
   00620 Pyruvate metabolism
    4340725
  Lipid metabolism
   00071 Fatty acid degradation
    4340725
   00561 Glycerolipid metabolism
    4340725
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4340725
   00310 Lysine degradation
    4340725
   00330 Arginine and proline metabolism
    4340725
   00340 Histidine metabolism
    4340725
   00380 Tryptophan metabolism
    4340725
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4340725
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4340725
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4340725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 4340725
NCBI-ProteinID: XP_015643334
UniProt: Q9FRX7
LinkDB All DBs
Position
6
AA seq 549 aa AA seqDB search
MAAAAARRGSSLLSRCLLSRPAAAASPAVPSALRRADGTQGLLPGILQRFSTAAVAEEPI
SPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAEDINRAVHAARKAFD
EGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAANIEVPMVARLMRYY
AGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVLK
TAEQTPLSALFASKLLHEAGLPDGVVNVVSGFGPTAGAALASHMDVDKIAFTGSTDTGKV
VLELAARSNLKSVTLELGGKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHE
RIYDEFVEKAKARALKRVVGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGD
RLGDKGYYIQPTIFSDVQDNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVF
TNNLNTANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVV
TPIKNAAWL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctgctgcaaggaggggctcatcgctgctctctcgctgcctgctgtccagg
cccgccgccgccgcctcgcctgctgtcccctctgcgctccgcagggcagatgggacacaa
ggattgttgccgggaatccttcagaggttcagcactgcagcagtagcagaggagcccata
tcacccccagtccaagtgaactacactcagctcctcattgatggaaaattcgttgattca
gcatctggcaaaactttcccaactctggaccctcgtaccggggagctgattgcccatgtg
gctgaaggcgatgcggaggatattaaccgtgcggttcatgcggcccgcaaggctttcgat
gaagggccatggccaaagatgactgcctatgagagatcccggattctgttgcggtttgct
gacttgattgagaagcacaacgatgaaattgctgcattggagacatgggacaacggcaag
ccgtatgcgcaagctgccaacattgaagtgccaatggtggcacggctgatgcggtactat
gctggttgggctgacaagatccatgggcttgtcgtgccggctgacggcccacaccatgta
caggtgctgcacgagcccattggtgtcgcaggtcagatcatcccatggaactttccgctt
ctgatgtttgcgtggaaagttggccctgctttggcttgtggaaacactgttgtgctcaag
acggctgagcaaactcctctgtctgctctatttgcttctaagctgttgcatgaggctgga
ctcccagacggtgttgttaacgtggtatctggttttggacctactgctggtgctgctctt
gctagtcacatggatgtcgataagattgcattcactggatcgaccgatactggaaaagtc
gtccttgagttggctgcaaggagcaaccttaagtcagtgacactggagctaggaggcaag
tctcctttcatcatcatggatgatgctgatgttgaccatgctgttgagcttgcgcatttt
gcactgttctttaaccagggacaatgttgctgtgctgggtctcgtacatttgtgcatgag
cgtatctatgatgagttcgtggagaaggccaaggctcgtgctctcaagcgtgtggttggt
gatccattcaagaatggtgttgaacagggccctcagattgatgacgagcaattcaacaag
atcttgcgctacatcaagtatggtgttgacagtggagccaaccttgtgactggtggcgac
agattaggtgacaaaggttactacatccagccaacaattttctcggatgtacaggataac
atgaggattgctcaagaagagatatttggccctgtgcagtccattctgaagttcaatgat
ctgaacgaggtcatcaagagggcaaatgcaagccagtacgggctggctgctggggtcttc
accaacaacctgaacacggccaacaccctgacccgcgcgctcagggtcgggaccgtgtgg
gtgaactgcttcgacgtcttcgacgccgcgatcccgttcggcggatacaagcagagcggc
atcgggagggagaagggcatcgacagcctgaagaactacctgcaggtcaaggccgtcgtc
acgccgatcaagaacgccgcgtggttgtaa

DBGET integrated database retrieval system