KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340748Help
Entry
4340748           CDS       T01015                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1 isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    4340748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4340748
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     4340748
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     4340748
   Polycomb group proteins
    PRC2-EZH2 complex
     4340748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 4340748
NCBI-ProteinID: XP_015644234
UniProt: Q5VN06
LinkDB All DBs
Position
6
AA seq 896 aa AA seqDB search
MAGDSRNEPMFCEEGSSESGYVLCVIDSLKKKITSDRFVYIQKRVEENSIKLSPITLHSH
NLSKNRQTSTSNSTDLVSNLLTKRKEDALCAVNSRESSPDESEGANCQDECSSTVIVGGN
LSARNSVRPIRLPEVATLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDS
EDEAVEDEEEKKEFKDSEDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGE
KPEGSSKKVSELNVKMEDVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEK
QAPLCSSDEGTPCGIHCYKLVSKPDAIMEIDSHLLVDVEEPTSDNLKDQIGSNKKKLGSS
GQKTKSQQSESSSTARVSSESSESEVQLLSNKSPQHSPGLSKNKLGAKGGIKKSTNRRIA
ERILMSVKKGQQEMSPDSNSIVNGCHWPRDMKLRSDTRSGIKDSVVSSQCNSPSTRSFRK
KGTLQMENNSSFVDAQSDSMEDTNNEHSATDGCDSSRKEECVDESICRQEAHGRSWKVIE
QGLLLKGLEIFGKNSCLIARNLLGGMKTCTDVFQYMNYIENSSASGALSGVDSLVKGYMK
GNELRTRSRFVRRRGRVRRLKYTWKTAGYHFIRKRITERKDQPCRQYTPCGCQSACGKQC
PCLTNGTCCEKYCGCPKMCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVGCG
DGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGEL
ISHKEADKRGKIYDRENSSFLFNLNNEYVLDAYRMGDKLKFANHSPDPNCYAKVIMVAGD
HRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEGPGAKDDAQPSTGRAKKLAH
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgattcccgaaatgagccgatgttttgcgaggaagggagcagtgaatcgggc
tatgttctatgtgttattgattcgctgaagaagaaaatcacatcggaccgctttgtttac
atccagaaaagggtagaggagaatagcattaagcttagcccgattacactgcactctcac
aatttgtcaaaaaataggcaaactagtacatccaacagtacagatttagtctcgaatttg
ctcacaaagaggaaagaagatgccctgtgtgctgtgaatagtcgtgagtcatctcctgat
gaaagtgaaggtgccaattgccaagatgagtgttcatcgactgttattgtgggtggaaat
ctatccgcgaggaattctgtccgtccgattagactaccagaagtggcaacactccctcca
tatacaacttggatatttttggacaggaaccagcggatgcaagaagaccaatctgtactt
ggtcgtcgaaggatttactatgatacaaactgtggcgaagctttaatttgcagtgatagt
gaagatgaagctgttgaggacgaggaagagaaaaaggagttcaaggattctgaagattgc
ataattcggatgaccattcaagaatgtggcatgtctgatgctgtgcttgaaactctagct
cgagatatcgaaagggctcctgatgatataaaggccaggtatgagatcctacaaggggag
aaacctgagggttcttccaagaaagtgtctgaacttaatgtcaaaatggaagacgtgtac
ggtgataaagatctggatgcagcattggattcctttgacaatctcttttgtcgccgatgt
ttggtttttgattgcaagctacatgggtgttctcaagatttagtatttccgactgaaaag
caggcaccattgtgcagctcggatgagggtacaccatgtggtattcactgttacaaactg
gtctctaaaccagatgctatcatggagattgattctcatttgcttgttgatgttgaggag
ccaacatcggacaatctaaaggatcagatagggtcaaataagaaaaagcttggttctagt
gggcagaaaacaaaatctcaacaaagtgaaagttcttcaactgcaagggtttcctcagaa
agcagtgagtctgaagtacaactgttaagcaataaatccccgcaacactctcctggcctc
tcaaaaaataagcttggcgcaaaaggtggaatcaagaaaagtactaacagaagaattgct
gagagaattctaatgagtgtgaaaaaggggcaacaggaaatgtcaccggactctaattct
attgttaatggatgccattggcctagggatatgaagcttagatctgatactaggagtgga
attaaggattctgttgtatcctcacagtgtaattctccaagcacaaggagttttagaaag
aagggcacacttcaaatggagaataactcatcttttgtggatgctcagagtgattcaatg
gaggatacaaataatgaacattcagcaacagatggttgtgatagttcaaggaaagaggaa
tgtgttgatgagagtatatgcaggcaagaagctcatggcaggtcctggaaagtgattgag
caagggcttctattgaaaggattagagatttttggaaagaacagttgtttaattgctcgg
aaccttctgggtgggatgaaaacatgcacagatgtttttcagtatatgaattacattgaa
aacagcagtgcatctggagctcttagtggtgttgattctcttgttaaaggatatatgaag
ggtaatgaattacggacaagatcaagatttgtgagaaggcgaggaagggtccgccgtttg
aagtacacctggaaaactgcaggctaccattttataaggaaaaggattacagaaaggaag
gatcagccttgtcgacaatacactccttgtggttgccagtctgcatgtgggaagcaatgt
ccatgtctcacaaatggtacctgctgtgagaaatactgtgggtgcccgaaaatgtgcaag
aatcgcttccgaggttgccattgcgcaaagagtcagtgtcgcagccggcagtgtccatgc
tttgctgctgacagggaatgtgatcctgatgtgtgtagaaactgctgggtagggtgcggt
gatggtacattgggagtccctaaccaaagaggtgataattatgaatgccggaacatgaaa
ctgctgcttaaacagcaacaaagggtcttacttgggagatctgatgtttctggctgggga
gctttcctcaagaatagtgttgggaagcacgagtatcttggcgagtacactggggagctt
atctcccataaagaagctgacaagcgtggaaagatatatgaccgtgagaattcatcgttc
cttttcaacttgaacaatgagtacgttcttgatgcctacagaatgggcgacaagctgaag
ttcgccaaccattcccctgatccaaactgctacgccaaggtcatcatggtagcaggcgat
cacagggtggggatcttcgccaaagagcggatcagcgcgggcgaggagctgttctacgac
taccgctacgagcccgaccgggccccggcgtgggctcgcaagcccgaggggcccggtgcc
aaggacgacgcccagccttccaccgggagagcaaagaagctcgcccactga

DBGET integrated database retrieval system