KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341340Help
Entry
4341340           CDS       T01015                                 

Definition
(RefSeq) ent-kaurene oxidase-like 5
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4341340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4341340
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     4341340
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP701 family
   4341340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 4341340
NCBI-ProteinID: XP_015641629
UniProt: Q5Z5S6
LinkDB All DBs
Position
6
AA seq 503 aa AA seqDB search
MESLLAAGAGGIGVAAAAAVVAATLAVVPPKDRGNNPPPAVPGLPVIGNMHQLKEKKPHH
TFTKWSKTYGPIYTIKTGASSVVVLNSTEVAKEAMIEKFSSISTKKLPKALSVISRKNMV
SISDYGDFYKMAKRNIMLAILGFNAQKHFCDTRERMVSNVLSSLHKLVAVDPHSPLNFRE
VYTTELFGLSLIQNLGEDVCSVYVEEFGREISKEEIFHVLVHEILSCVVEPDWRDYFPYL
SWLPNKSFETIVSSTEFRRDAVMNALIKRQKERIARGEARISYIDFLLEAKNSTQLTDHQ
LMLLLAESIAAAVDTVLVTTEWAMYELAKNPDKQEWLYREIREVCGGKAVTEEDLPRLPY
LDAVLHETLRLHSPVPVLPTRFVHDDTTLAGYDVPAGTQVMINVFGCHMDEEAWESPGEW
SPERFLGEGFKLADRYKTLAFGAGRRTCAGSQQAVSIACVAIARFVQELQWTLREGDGDK
EDTMQYTALKLHPLHVHLKPRGS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgctgctcgcagccggtgcgggagggatcggcgtggctgcggcggccgccgtc
gtggcggcgaccctcgccgtggtgccgcccaaggaccgcggcaacaacccgcctccagct
gttcctggtttacccgttattggaaatatgcatcaattgaaagaaaagaagcctcatcat
acctttacaaaatggtctaaaacttatgggccaatctacactataaagaccggagcttct
tcagtagttgtgctcaattcaacggaagtagccaaggaggcgatgattgaaaaattctca
tcaatatcaactaaaaagctaccaaaagcattgtctgtgataagccgtaaaaacatggtt
tccatcagcgactatggtgacttctataagatggcgaagcgtaatattatgctcgcaatt
ttaggttttaatgcgcagaaacacttctgcgatacaagagaaaggatggtcagtaacgtg
ttaagcagtttgcataaattggttgctgttgacccacattcccctctgaacttcagagaa
gtttacactactgagctattcggattgtccttgatccagaatttaggtgaggatgtgtgt
tcagtttatgtggaagagtttgggagggagatatccaaggaagagatcttccatgtcctt
gtgcatgagatattgtcgtgtgtcgtggagcctgattggagggactacttcccctacctc
agctggcttccaaacaagagcttcgaaacaatagtgtctagtacagaatttagacgagat
gctgtgatgaacgcgttgatcaagaggcagaaggaaaggattgcgcgcggagaggcaagg
atatcctatattgacttcttgctggaagctaagaacagtacacagctgacagatcaccaa
ctgatgctgctgctggcggagtccatcgctgctgctgtggatactgtcctggtaaccact
gaatgggccatgtatgagcttgccaagaaccctgacaaacaggaatggctttaccgggag
attcgagaggtgtgcggcggcaaggcggtgaccgaggaggacctaccaaggctgccgtac
ctcgacgccgtgctccacgagacgctgcggctgcactccccggtgccggtgctccccacg
aggttcgtccacgacgacaccacgctcgccggctacgacgtccccgcgggcacccaggtg
atgatcaacgtgttcgggtgccacatggacgaggaggcctgggagtcgcccggagagtgg
tcgccggagagattcctcggcgaggggttcaagttggccgacaggtacaagacgctggcg
ttcggcgccgggaggaggacctgcgcggggagccagcaggcggtgagcatcgcgtgcgtc
gccatcgcgcgcttcgtgcaggagctccagtggacgctgagggagggcgacggtgataag
gaggataccatgcagtacactgccttgaagcttcacccgctgcacgtgcacctcaagccc
agaggaagctag

DBGET integrated database retrieval system