KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341824Help
Entry
4341824           CDS       T01015                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700 isoform X2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4341824
   00500 Starch and sucrose metabolism
    4341824
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     4341824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 4341824
NCBI-ProteinID: XP_015643120
UniProt: Q653V7
LinkDB All DBs
Position
6
AA seq 885 aa AA seqDB search
MMGSPPAPPARRLGALAVFLLALFLAAPWGVDCGYNVASVAGSKNRLRARLELAGGGGGA
APELGPDVRRLSLTASLETDSRLHVRITDADHPRWEVPQDVIPRPSPDSFLAATRPGGGR
VLSTATSDLTFAIHTSPFRFTVTRRSTGDVLFDTTPNLVFKDRYLELTSSLPPPGRASLY
GLGEQTKRTFRLQRNDTFTLWNSDIAAGNVDLNLYGSHPFYMDVRSGGGGGGGAAHGVLL
LNSNGMDVIYGGSYVTYKVIGGVLDFYFFAGPSPLAVVDQYTQLIGRPAPMPYWSFGFHQ
CRYGYKNVADLEGVVAGYAKARIPLEVMWTDIDYMDAYKDFTLDPVNFPADRMRPFVDRL
HRNGQKFVVIIDPGINVNTTYGTFVRGMKQDIFLKWNGSNYLGVVWPGNVYFPDFLNPRA
AEFWAREIAAFRRTLPVDGLWVDMNEISNFVDPPPLNAIDDPPYRINNSGVRRPINNKTV
PASAVHYGGVAEYDAHNLFGFLEARATHDALLRDTGRRPFVLSRSTFVGSGRYTAHWTGD
NAATWEDLHYSINTMLSFGLFGIPMIGADICGFGGNTTEELCSRWIQLGAFYPFSRDHSA
IGTVRRELYLWESVARSARKALGLRYRLLPYLYTLMYEAHTTGAPIARPLFFSYPGDVET
YGIDRQFLLGRGVLVSPVLEPGATTVTAYFPAGRWFSLYDFSLAVATKTGKRVTLPAPAD
TVNVHVAGGNILTLQQPALTSSRVRQSVVHLLVALADDGTATGDLFLDDGESPEMAGPRS
RWSQIKFSGATESGGGVVRVRSHVVHDSYAPSRTMAIGKVVLMGLRSAAPPKGFAVYANG
VQVNASTAVGGAAGSPEKGALGVAHVSGLTLVVGQEFDLKVVMTY
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgatgggctcgccgccggcgccgccggcgcgtcgtcttggcgctctcgccgtcttcttg
ctcgctctcttcctcgccgcgccgtggggcgtcgactgcgggtacaacgtcgcgtcggtg
gccgggtcgaagaaccggctgagggcgcggctggagctcgccggcggcggcggcggcgcg
gcgccggagctcggccccgacgtgcggcggctcagcctgacagcgagcctggagacggac
agccggctacacgtccgcatcaccgacgccgaccaccctcgatgggaggtgccccaggac
gtcatcccgcgcccctcgccggactccttcctcgccgccacacgcccaggcggcggccgc
gtcctctccacggcgacctccgacctcaccttcgccatccacacctccccgttccgcttc
accgtcacccgccgctccaccggtgacgtcctcttcgacaccaccccaaacctcgtcttc
aaggatcgctacctcgagctcacctcctcgctgccgccgcccggccgcgcgtcgctgtac
ggcctcggcgagcagaccaagcgcacgttccggctccagcggaatgacaccttcacgctc
tggaactccgacatcgccgccggcaacgtcgacctcaacctgtacggctcccaccccttc
tacatggacgtgcgctccggcggcggcggcggcggcggcgcggcgcacggcgtgctcctc
cttaacagcaacggcatggacgtcatctatggcggatcctacgtcacctacaaggtgatc
ggcggcgtgctggatttctacttcttcgccggcccgtcccctctcgccgtcgtcgaccag
tacacccagctcatcggccgacctgcccccatgccgtactggtcattcgggttccaccag
tgcaggtacgggtacaagaacgtggctgatcttgagggcgtcgtcgccggctacgccaag
gcgaggatcccactggaggtgatgtggacggacatcgattacatggacgcctacaaggac
ttcacgcttgatccggtgaacttcccggccgaccggatgcggccgttcgtcgaccgcctc
caccgcaacggccagaagttcgtcgtcatcattgacccagggatcaacgtgaacacgacg
tacgggacgttcgtccggggaatgaagcaggacatcttcttgaagtggaacgggagcaac
tacctcggcgtggtgtggccggggaacgtctacttcccggacttcctcaacccgcgcgcc
gccgagttctgggcgcgcgagatcgccgcgttccggcggaccctccccgtcgacgggctg
tgggtcgacatgaacgagatctccaacttcgtcgacccgccgccgctcaacgcgatcgac
gacccgccgtaccgcatcaacaactccggcgtgcgccgccccatcaacaacaagacggtg
ccggcctccgccgtgcactacggcggcgtggccgagtacgacgcgcacaacctcttcggc
ttcctcgaggcgcgggccacgcacgacgcgctgctccgtgacaccggccgccggccgttc
gtgctcagccgctccacgttcgtcggctccggcaggtacaccgctcactggaccggcgac
aacgccgcgacgtgggaggacctccactactccatcaacaccatgctcagcttcggcctc
ttcggcatccccatgatcggcgccgacatctgcggcttcggcggcaacaccaccgaggag
ctctgcagccgctggattcagcttggcgcgttctacccgttctcgagggatcactcggcg
atcggcaccgtccggcgagagctgtacctgtgggagtcggtggcgaggtcggcgaggaag
gcgctcggcctgcgctaccggctgctcccctacttgtacacgctcatgtacgaggcgcac
accaccggcgcgcccatcgcgcggccgctcttcttctcctaccccggcgacgtcgagacg
tacggcatcgacaggcagttcctgctcgggcgcggcgtgctcgtgtcgccggtgctcgag
ccgggcgcgaccaccgtcaccgcctacttcccggccggacggtggttcagcctctacgac
ttctccctcgccgtcgccacgaagaccggcaagcgcgtgacgctgcccgcgccggcggac
acggtgaacgtgcacgtcgccggcgggaacatcctgacgctgcagcagcccgcgctgacg
tcgtcgcgcgtgcgccagagcgtggtccacctcctggtcgcgctcgccgacgacggcacg
gccaccggggatctcttcctggacgacggcgagtcgccggagatggccgggccacggagc
aggtggagccagatcaaattcagcggcgcgaccgagagcggcggcggcgtggtcagagtg
aggtcgcatgtggtgcacgactcgtacgcgccgagccggacgatggccatcggcaaggtg
gtgctcatggggctccggtcggcggcgccgcccaaggggttcgccgtttatgccaacggc
gtccaggtgaacgcgagcacggcggtcggcggcgccgccgggagcccggagaagggagcg
ctgggcgtcgcgcacgtcagcgggctgacgctggtcgtcgggcaggagttcgatctcaag
gtcgtgatgacctattaa

DBGET integrated database retrieval system