KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341833Help
Entry
4341833           CDS       T01015                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4341833
   00500 Starch and sucrose metabolism
    4341833
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     4341833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 4341833
NCBI-ProteinID: XP_015640953
UniProt: Q653V4
LinkDB All DBs
Position
6
AA seq 886 aa AA seqDB search
MATRARPPLVLLLCLCLASCLSSAIGGVSAAGNGYRTTAFLVDEEGRRLRAELAAVAGAG
GGSTAAYGDDVQRLDVYASLETDSRLHVRIADADGPRWEVPQDVIPRPSPEFFLQTSRPG
RPVLSTATSDLTFAIHASSPFRFAVSRRSTGDVLFDTSPNLVFKDRYLELTSSLPPPGRA
SLYGLGEQTKRTFRLQRNDTFTLWNSDIAAGNVDLNLYGSHPFYMDVRSGGGGAAHGVLL
LNSNGMDVIYGGSYVTYKVIGGVLDFYFFAGPSPLAVVDQYTQLIGRPAPMPYWSFGFHQ
CRWGYKNVSDLEGVVAGYAKARIPLDVMWTDIDYMDAFKDFTLDPANFPADLLRPFVDRL
HRNGQKYVVIIDPGISVNATYGTFIRAIKEDIFLKWNGSNYLGVVWPGNVSFPDFLNPRA
AEFWAREIAAFRRTLPVDGLWIDMNEISNFVDPPPLNALDDPPYRIDNSGVRRPINNKTV
PASAVHYGGVAEYDAHNLFGFLEARATHDALLRDTGRRPFVLSRSTFVGSGRYTAHWTGD
NFATWDDLRYSINTMLSFGLFGIPMIGADICGFGGNTTEELCSRWIQLGAFYPFSRDHSA
IGTVRRELYLWESVARSARKALGLRYRLLPYLYTLMYEAHTTGAPIARPLFFSYPGDVAT
YGIDRQFLLGRGVLVSPVLEPGATTVTAYFPAGRWFSLYDFSLAVATKTGKRVTLPAPAD
TVNVHVAGGNILTLQQPALTSSRVRQSVVHLLVALAEDGTATGDLFLDDGESPEMVGARS
RWSQIKFSGATESGGSVVRVRSHVVHDSYAPSRTMVIAKVVLMGLRSPVPPKGFAVYANG
VQVNASTAVDGGGGGNPEKGALGVAHVGGLSLVVGQEFDLKVVMTY
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagagctcggccgccattggtgctattgctgtgtctctgcttggcttcttgc
ttgagctcggccattggtggcgtttcagctgccggcaatggctaccggaccacggcattc
ctggtggatgaggaagggaggcggctcagagccgagctcgccgcagtcgccggcgccggc
ggcgggtccacggcggcgtacggcgacgacgtgcagaggctagacgtgtatgccagcctg
gagacggacagccggctgcacgttcgcatcgccgacgccgacggcccgcgatgggaggtg
ccccaggacgtcatcccgcgcccctcgccggagttcttcctccagacgtcgcgtccgggc
cggcccgtcctctccacggcgacctccgacctcaccttcgccatccacgcctcctccccg
ttccgcttcgccgtctcccgccgctccactggcgacgtcctcttcgacacctcccccaac
ctcgtcttcaaggatcgctacctcgagctcacctcctcgctgccgccgcccggccgcgcg
tcgctgtacggcctcggcgagcagaccaagcgcacgttccggctccagcggaatgacacc
ttcacgctctggaactccgacatcgccgccggcaacgtcgacctcaacctctacggctcc
caccccttctacatggacgtccggtcaggcggcggcggcgcggcgcacggcgtgctcctc
cttaacagcaacggcatggacgtcatctatggtggatcgtacgtcacctacaaggtgatc
ggcggcgtgctggatttctacttcttcgccggcccgtcccctctcgccgtcgtcgaccag
tacacccagctcatcggccgccctgcccccatgccgtactggtcattcgggttccaccag
tgcaggtgggggtacaagaacgtgtctgacctggagggcgtggtcgccggctatgccaag
gcgaggatcccgctggacgtgatgtggacggacatcgactacatggacgccttcaaggac
ttcacgcttgatccggcgaacttcccggccgacctgctccggccgttcgtcgaccgcctc
caccgcaacggccagaagtacgtcgtcatcattgacccagggatcagtgtgaacgcgacg
tacgggacgttcatccgagcgatcaaggaggacatcttcttgaagtggaacgggagtaac
tacctcggtgtggtgtggccggggaacgtctccttcccggacttcctcaacccgcgcgcc
gccgagttctgggcgcgcgagatcgccgcgttccggcggaccctccccgtcgacgggctg
tggatcgacatgaacgagatctccaacttcgtcgacccgccgccgctcaacgcgctcgac
gacccgccgtaccgcatcgacaactccggcgtgcgccgccccatcaacaacaagacggtg
ccggcctccgccgtgcactacggcggcgtggccgagtacgacgcgcacaacctcttcggc
ttcctcgaggcgcgggccacgcacgacgcgctgctccgtgacaccggccgccgcccgttc
gtgctcagccgctccacgttcgtcggctccggcaggtacaccgcgcactggaccggcgac
aacttcgcgacgtgggacgacctccgctactccatcaacactatgcttagcttcggcctc
ttcggcatccccatgatcggtgccgacatctgcggcttcggcggaaacaccaccgaggag
ctctgcagccgatggattcagcttggcgcgttctacccgttctcgagggaccactcggcg
atcggcaccgtccggcgagagctgtacctgtgggaatcggtggcgaggtcggcgaggaag
gcgctcggcctgcgctaccggctgctcccctacttgtacacgctcatgtacgaggcgcac
accacgggcgcgcccatcgcgcggccgctcttcttctcctaccccggcgacgtcgcgacg
tacggcatcgacaggcagttcctgctcggccgcggcgtgctcgtgtcaccggtgctcgag
ccgggcgcgaccaccgtcaccgcctacttcccggcgggacggtggttcagcctctacgac
ttctccctcgccgtcgccacgaagaccggcaagcgcgtgacgctgcccgcgccggcggac
acggtgaacgtgcacgtcgccggcgggaacatcctgacgctgcagcagcccgcgctgacg
tcgtcgcgcgtgcgccagagcgtggtccacctcctggtcgccctcgccgaggacggcacg
gccaccggggatctcttcttggacgacggcgagtcgccggagatggtcggggcgcggagc
aggtggagccagatcaaattcagcggcgcgaccgagagcggcggcagcgtcgtcagagtg
aggtcgcacgtggtgcacgactcgtacgcgccgagccggacgatggtcatcgccaaggtg
gtgctcatggggcttcgatcgccggtgccgcccaaggggttcgccgtttatgccaacggc
gtccaggtgaacgcgagcacggcggtcgacggcggcggcggcgggaacccggagaaggga
gcgctgggcgtggcgcacgtcggcgggctgtcgctggtcgtcgggcaggagttcgatctc
aaggtcgttatgacctattaa

DBGET integrated database retrieval system