KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342350Help
Entry
4342350           CDS       T01015                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4342350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4342350
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     4342350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 4342350
NCBI-ProteinID: XP_015646992
UniProt: Q6ZDY8
LinkDB All DBs
Position
7
AA seq 630 aa AA seqDB search
MWRGCVSRGLRSLSKGKGSSSSAPVSAAARLFSTASSSYTVVDHSYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSEGTCQGVIALNMEDGTLHRFRATNTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGDNPDSVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAETAKPGEKQKPLQKSAGEKTIA
WLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLITKAWESYHDVKISDR
SLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSLGYWE
NEKVRLAYRPVHMNTLDSEVESFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcggctgcgtctcgcgtggcctcaggagcctctccaagggcaagggctcctcc
tcctccgcccccgtctccgccgccgctaggctcttctccaccgcctcgtcgtcgtacacg
gtggtggatcactcgtatgacgcggtcgtggtgggagccggcggcgcggggctccgtgcg
gcgatcgggctctccgagcacgggttcaacacggcttgcatcaccaagctcttccccacg
cggtcgcacaccgtcgcggcgcagggtggcataaatgctgctcttggaaacatgacggaa
gatgactggagatggcatatgtatgacactgtcaagggtagtgattggcttggtgaccag
gattctattcagtatatgtgcagagaagcaccaaaagcagttatagaacttgaaaactat
gggttgccattttcaagaactgaagatggaaagatataccaacgggcctttggaggccag
agcttagattttgggaaaggtgggcaggcctatcgatgtgcatgtgctgctgacagaaca
ggacatgctatgttacacactctgtatggtcaagcaatgaagcataatactcagttcttt
gtagaatattttgcgctagaccttatcatggacagtgaaggcacctgtcagggggttatt
gctttgaacatggaggatggcactcttcaccgtttccgtgctacaaatacaattctggcc
acaggaggttatggcagagcctacttctcagcaacctcagctcacacatgcactggagat
ggcaacgctatggttgcacgtgctggtttaccacttcaggaccttgagtttgtgcagttc
catcctacaggcatttatggtgctggatgccttatcactgaaggttcccgtggtgaaggt
ggtatccttaggaacagtgaaggcgagcgtttcatggaacgatatgctcctactgcaaaa
gatcttgcttctcgagatgttgtttcaagatctatgacaatggaaatcagagaaggccgt
ggtgttgggccattgaaggaccacatctatctgcatcttaaccatctgcctccagaagtt
cttaaggagaggcttcctggtatttctgaaactgctgctatttttgctggtgttgatgtc
accaaggagcccattcctgtcttgcctactgtgcactataatatgggtgggatcccaaca
aattaccatggagaggtagtgactatgaagggtgacaatcctgattctgttgttcctggt
ttgatggctgcgggagaagcagcatgtgcatctgttcatggtgcaaatcgtctgggtgca
aattcacttcttgacatagttgtttttggcagagcttgtgcaaacagggtagctgaaacc
gctaagccaggtgagaagcagaaacctcttcaaaaaagtgctggagaaaagaccatagcc
tggttagacaagctgagaaatgcaaatggatcattgccaacttccaagatccgtctaaac
atgcaacgtgttatgcaaaataatgctgctgtcttccgtacgcaagaaacactcgaggaa
ggttgcaaattgattaccaaggcatgggaaagttatcatgatgtgaagatcagtgaccgg
agtctcatatggaattcagatttgatagagaccattgagttggaaaatctcttgataaat
gcatgcataaccatgcactcagcagaggctcggaaggaaagcagaggagctcatgctcgt
gaagatttcacgaaaagagatgatgagcaatggatgaagcactcgctggggtactgggag
aatgagaaggttcgcttggcatacaggccagtccacatgaacacattggacagtgaagtt
gagtcgttcccacccaaggcgcgtgtttattag

DBGET integrated database retrieval system