KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343045Help
Entry
4343045           CDS       T01015                                 

Definition
(RefSeq) alpha-glucosidase 2 isoform X1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4343045
   00500 Starch and sucrose metabolism
    4343045
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     4343045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 Gsf2
Motif
Other DBs
NCBI-GeneID: 4343045
NCBI-ProteinID: XP_015645091
UniProt: Q0D6X6
LinkDB All DBs
Position
7
AA seq 980 aa AA seqDB search
MAASGKEAMVWVRILEEGVFRFDASEAARAAAGPSLSFAVPRRREEPRAGGDRPAIVPVC
EVVGDVQRVVVELPSGTSFYGTGESSGPLERTGKLVITWNTDAWDYGPGTTSLYQSHPWV
LAVLPDGKALGVLADTTCRCEIDLRQESTMKFSASCTYPVILFGPFNTPSEVTTSLSHAI
GTVSMPPKWSLGYHQCRYSYDSSEKVLQVVKTFRERGIPCDVVWMDIDYMDGFRCFTFSH
RFPDPKCMVDDLHSVGCKAIWMLDPGIKNESGYFVFDSGLESDVWVQKEDKQPFVGEVWP
GDCVFPDFTCERARSWWSGLVRQFVSNSVDGLWNDMNEPAVFNTATKTMPESNIHRGDAN
IGGLQNHPYYHNVYGMLMAKSTYEGMKLANPTKRPFVLTRAGFIGQQRYAAMWTGDNVSN
WEHLHMSIAMVLQLGLSGQPFAGPDIGGFAGNATPKLFGRWMGVGALFPFSRGHSDKGSL
DHEPWSFGEECEEVCRLALLRRYRLLPHIYTLFYLSHTNGTPVAAPVYFADPQDLELRKI
ETSFLLGSLLVCASTCPDKGAHESSQKLPKGIWLPFDFGDSHPDLPMMYLRGGAVLPIGL
PLNHVGEAKLDDNLSLIIALDENGKAEGVLFEDDGDGYEFLQGNYLLTYYVAELHSSVVT
VKVARTEGSWKRPNRNLKINILLGGGAMVSTHGIDGEDLHLTMPTESEVSSLVATSELEL
KKRFEMVRPIPDIDKPLGKEVAELSEIPIDLNGEDWLVKVVPQIGGRIISMTHLPSDSQW
LHSTNRINGYEEYNAAEDTAGCTEEYKVIRRYREQSGKEESICLEGDIGGGLVLQRQISI
CKENPKIVKIDSSIRAKQGADHSGGFSGLACLRVRPSFILQYPTEVSVVFTASNGIKREI
LPDSGELTFEGVLRPNGEWMLVDKRTNLSLVNCFDLSQVSICKLHWGTDHLNMELWSEQR
AVSKDTPLRICHHYEVRKIN
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcggggaaggaagcgatggtgtgggtgcggatactggaggagggggtgttc
cggttcgacgcgtcggaggccgcgcgggcggcggcggggcccagcctctcgttcgccgtg
ccgcggcggcgagaggagccgcgcgccggaggggaccgcccggcgatcgtgccggtgtgc
gaggtggtgggagatgtccagcgcgtcgtggttgagcttccttctgggacatctttctat
ggtactggagaatcaagtgggccacttgagagaactggaaagctggttattacttggaac
acggatgcatgggattatggtccaggaaccacatcactatatcagtcacacccttgggta
ctggctgttcttcctgatgggaaggcattgggagtccttgctgacactacttgccgctgt
gagattgacttacggcaagaatctactatgaaattttctgcttcatgcacttaccctgtc
atactgtttggaccttttaatacaccctctgaagttaccacatccttgtctcatgcaatt
ggaactgtgtccatgccaccaaaatggtcactcggataccatcaatgtcgttatagctat
gactcttctgagaaagtactgcaggttgttaaaacatttagagaaagaggcattccttgt
gatgttgtatggatggatattgattacatggatggttttaggtgctttacgtttagccat
cgtttccctgatccgaaatgtatggttgatgatctccattcggttggctgcaaagcaata
tggatgcttgacccaggaatcaagaatgagagcggttactttgtgtttgatagcggttta
gaaagtgatgtttgggttcaaaaggaagacaagcagccgttcgttggagaagtatggcct
ggtgattgtgttttccctgattttacttgtgaaagagcccgctcctggtggtctggctta
gtaaggcagttcgtctctaatagcgttgatggattatggaatgatatgaatgaacctgct
gtttttaatactgccaccaaaacaatgccagaaagcaatatccatagaggagatgctaat
attggtggtctccagaatcatccgtactaccataacgtctatggaatgctcatggcaaaa
tctacttatgagggaatgaaattggccaatccaactaaacggccatttgttcttactcga
gctggttttataggacaacaacgctatgctgctatgtggactggtgataatgtatcaaac
tgggaacatctccacatgagtatagccatggttcttcagttgggtcttagtggtcaacca
tttgcaggcccagatattggtgggtttgctgggaatgctactccaaaactttttggaaga
tggatgggagtgggtgcattgtttccattttctcgtggccattctgataaaggaagcttg
gaccatgagccgtggtcctttggggaagagtgtgaggaggtttgtcgccttgctttacta
agacggtaccggctattaccacacatttatactctattttacctttctcatacgaacgga
actcctgttgctgctccagtttacttcgcagatccacaagatttagagttaaggaaaatt
gagacctcatttctcttgggatcacttctagtttgtgcaagcacttgtcctgataaagga
gctcatgaatcttcacagaagctgccaaagggaatttggttgccttttgattttggagat
tcacaccctgatctgccgatgatgtatttacgaggtggagcagtacttcccataggcctt
cctctcaatcatgttggtgaagcaaaattggatgataatttgtcattgattattgcatta
gatgaaaatggaaaagctgaaggtgtcctctttgaagatgatggggatggatatgagttc
cttcaagggaattatcttttgacatactatgttgcagaactccactcatcagtggttact
gttaaagttgcccgaactgaaggatcatggaagagaccaaatcgcaacttaaaaataaat
atattgcttggaggaggtgctatggtaagtacgcacggcattgatggggaagatttacat
ctaacaatgcctactgaatctgaagtgtcaagtctagtggcaacaagtgaacttgagctc
aaaaaacgttttgagatggttcgacctattccagacatagataagccattagggaaggaa
gtggctgaactttctgaaatacctattgatttgaacggcgaggactggttggttaaagtt
gtaccccagatcggtggtcgtattatctcaatgacacatcttccatctgattctcaatgg
ctacacagcacaaataggatcaatgggtatgaggaatataatgcggctgaagatactgct
ggctgcacagaagagtacaaagtcattaggaggtatcgcgagcaatcaggaaaagaggaa
tctatttgtttggaaggagatattgggggtggtttggttcttcagcgccaaatatccatt
tgtaaggaaaacccaaagattgttaagatcgactccagtattcgagcaaaacagggagct
gatcattctggtgggttttcagggttggcctgtttgagggttcgtcctagtttcattctt
cagtaccctacagaggtttctgttgtgtttacagcaagcaacggtataaagcgagaaata
cttccagattctggagaattgacatttgagggagttcttcgtcccaatggggaatggatg
ctagttgacaaacgtacgaatctgagcctggtaaattgcttcgatctcagtcaggttagt
atatgtaagttgcattggggaactgatcatttgaacatggaactgtggtcggagcaaaga
gcagtttctaaggacacaccgttaagaatttgccaccattatgaggtgagaaaaataaac
taa

DBGET integrated database retrieval system