KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345332Help
Entry
4345332           CDS       T01015                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     4345332
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     4345332
   HDAC complexes
    Sin3A-HDAC complex
     4345332
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    4345332
  Chromatin remodeling factors
   NuRD complex
    4345332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 4345332
NCBI-ProteinID: XP_015648088
UniProt: Q6ZB59
LinkDB All DBs
Position
8
AA seq 458 aa AA seqDB search
MAASGEGASLASAAGGEDGRRRRVSYFYEPSIGDYYYGQGHPMKPHRIRMAHSLVVHYGL
HRLLELSRPYPASDADIRRFHSDDYVAFLASATGNPALLDARAVKRFNVGEDCPVFDGLF
PFCQASAGGSIGAAVKLNRGDADITVNWAGGLHHAKKGEASGFCYVNDIVLAILELLKFH
RRVLYVDIDVHHGDGVEEAFFTTNRVMTCSFHKYGDFFPGTGHITDVGAGEGKHYALNVP
LSDGIDDDTFRDLFQCIIKKVMEVYQPDVVVLQCGADSLAGDRLGCFNLSVKGHADCLRY
LRSFNIPMMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNDYYEYFGPDYNLHIQP
RSVENLNSTKDLENIKSMILDHLSKIEHVPSTQFHDRPSDPEAPEQEEEDMDKRPPQRSR
LWSGGAYESDTEDPDNMKTETNDLSASSVMKDESNDDS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccggcgagggggcgtcgctggcgtcggcggcgggaggggaggacgggcgg
cggcggcgggtgagctacttctacgagccgtcgatcggggactactactacgggcagggg
cacccgatgaagccccatcgcatccgcatggcgcactcgctggtggtccactacggcctc
caccgcctcctcgagctctcccgcccctacccggcctccgacgccgacatccgccgcttc
cactccgacgactacgtcgccttcctcgcctccgccaccgggaaccccgccctgctcgac
gcccgcgccgtcaagcgcttcaacgtcggcgaggactgcccggtcttcgacggcctcttc
cccttctgccaggcctccgcggggggcagcatcggcgccgccgtcaagctcaaccgcggc
gacgccgacatcaccgtcaactgggcggggggcctccaccacgccaagaagggcgaggcc
tccggcttctgctacgtcaacgacatcgtcctcgccatcctcgagctcctcaagttccac
aggcgtgtgctatatgtagacattgatgtccaccatggagatggcgtggaggaagctttc
ttcactacgaatcgagtcatgacttgttcctttcacaagtatggggactttttccctggt
actgggcatatcactgatgttggagcaggcgaaggaaaacattatgctttaaatgtgccc
ctgagtgatggcattgatgatgatacctttcgtgatctgttccagtgcatcatcaaaaag
gtaatggaggtttatcagccagatgtagttgttctccagtgtggagccgactctttggct
ggagacaggttaggttgcttcaacctgtctgtgaaaggtcatgcagactgcctccgttac
cttaggtcattcaatattcctatgatggttttgggaggtgggggttacaccatcagaaat
gttgctcgctgctggtgctatgagactgcagttgctgttggagttgaacctgataacaag
ttaccttataatgactactatgagtactttggtcctgattataatctccatattcaaccc
agaagtgtggagaacctgaattcgactaaagacctggagaacataaagagcatgatattg
gatcatctctcaaaaattgagcatgttccgagcactcagttccatgacagaccatcagat
cctgaagctccagagcaggaagaggaggacatggacaagagaccacctcagcgcagtagg
ttatggagtggaggagcttatgaatctgatacagaggatcctgacaacatgaaaactgag
accaatgacttatctgccagctctgtcatgaaggatgaatcgaatgatgattcctag

DBGET integrated database retrieval system