KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345640Help
Entry
4345640           CDS       T01015                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4345640
   00020 Citrate cycle (TCA cycle)
    4345640
   00620 Pyruvate metabolism
    4345640
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4345640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PASTA
Motif
Other DBs
NCBI-GeneID: 4345640
NCBI-ProteinID: XP_015650015
UniProt: Q6ZKB1
LinkDB All DBs
Position
8
AA seq 475 aa AA seqDB search
MATTPAPVSLSAAASTVPARLLVGRGAAAAPVARRRARMVVVRAKIREIFMPALSSTMTE
GKIVSWSAAEGDRVAKGDAVVVVESDKADMDVETFHDGIVAAVLVPAGESAPVGAPIALL
AESEDDLQAALAKAQELSKAHPQQAPPPSDAAAPPPPPPPPAAAPAAPAPVAAGTKGIAT
PQAKKLAKQHRVDLAKVAGTGPFGRITPADVEAAAGIEPKPKVVPAASAAPVPLSAPAIG
AVPQAAELPPVPGATVVPFTGMQAAVSKNMVESLAVPAFRVGYPIVTDKLDELYEKVKSK
GVTMTVLLAKAAAMALAQHPVVNASCRDGKSFTYNTNINIAVAVAIDGGLITPVLEDADK
LDIYLLSQKWKELVKKARAKQLQPNEYSSGTFTLSNLGMFGVDRFDAILPPGQGGIMAVG
ASKPTVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgactccagcgcccgtctcgctctcggccgcggcctccaccgtgccggcgcgc
ctcctcgtggggcggggcgccgcggcggcgccggtggcgaggcggcgggcgaggatggtg
gtggtgcgggccaagatccgggagatcttcatgccggcgctgagctccaccatgacggaa
gggaagatcgtgtcgtggtcggccgccgagggggaccgcgtcgccaagggggacgccgtg
gtggtcgtcgagtccgacaaggccgacatggacgtcgagacgttccacgacggcatcgtc
gccgccgtcctcgtccccgccggtgagtccgcccccgtcggcgcccccatcgcgctgctc
gccgagtccgaggacgacctccaggccgccctcgccaaggcccaggagctctccaaggcc
cacccgcagcaggcgcctccaccctccgatgccgccgcgccgccaccgccgcctcctcca
cccgcggccgctccggcggctccggcgccggtggcagccggcacgaagggcattgccacc
ccgcaagctaagaagctggccaagcagcatagggtggacctagctaaggtggctggcact
gggccgttcgggcgaattacgccggccgatgttgaggctgccgccggcatcgagccgaag
ccgaaggttgtgcctgctgcttctgctgctcccgtgccgctgtctgctccggcaattggc
gccgtgccacaggccgcggagcttcctccggtgcccggtgccacggtggttccattcact
ggcatgcaggctgcagtgagcaagaacatggtggagagcctcgcggtgcccgcattccgt
gtgggatacccaattgtgaccgataagctcgatgagctatatgagaaggtcaagtcaaag
ggggtgaccatgacagttctgctggcgaaggccgcagctatggcacttgcgcagcacccg
gtggtgaatgctagctgcagggatgggaagagcttcacttacaacaccaacatcaacatc
gcggtggctgtcgcaatcgatggtgggctcattacacctgttctggaggatgctgataag
ttggatatatatttgctctcacaaaaatggaaggaactagtcaagaaagctcgtgcaaaa
cagctccaaccaaatgagtacagctctgggacatttacactgtcaaacttgggtatgttt
ggtgttgatagatttgatgcaattcttccacctggccagggaggcataatggctgtcgga
gcctcaaaacctacagtggtggctgataaagatggtttctttagtgtcaagagcaaaatg
ctggttaatgtcactgctgatcacagaattgtatacggtgctgatctggcagcattcctg
caaacttttgcaaagattattgaggatcctgagagcttaactttgtaa

DBGET integrated database retrieval system