KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346329Help
Entry
4346329           CDS       T01015                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4346329
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4346329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 4346329
NCBI-ProteinID: XP_015649518
UniProt: P93407
LinkDB All DBs
Position
8
AA seq 211 aa AA seqDB search
MQAILAAAMAAQTLLFSATAPPASLFQSPSSARPFHSLRLAAGPAGAAAARALVVADATK
KAVAVLKGTSQVEGVVTLTQDDQGPTTVNVRVTGLTPGLHGFHLHEFGDTTNGCISTGPH
FNPNNLTHGAPEDEVRHAGDLGNIVANAEGVAEATIVDKQIPLSGPNSVVGRAFVVHELE
DDLGKGGHELSLSTGNAGGRLACGVVGLTPL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatcctcgccgctgccatggccgcccagaccctcttgttctccgccaccgcc
cctcccgcctcccttttccagtccccttcctctgcccgccctttccactcgctccgcctc
gccgccggccccgcgggcgccgccgctgccagggcgctcgtcgtcgccgacgccaccaag
aaggccgtcgccgtgctcaagggcacctcccaggttgagggagtcgtcaccctcacccag
gatgaccaaggtcctacaacagtgaatgtccgtgtgacgggacttactcctggacttcac
ggcttccacctccacgagtttggcgatactacgaatgggtgcatatcaacaggaccacat
tttaacccaaacaatttgacgcacggtgcaccagaagatgaagtccgtcatgcgggtgac
ctgggaaacattgttgccaatgctgaaggtgtagctgaggcaaccattgttgataagcag
attcctctgagtggcccaaattctgttgttgggagagcattcgttgttcatgagcttgaa
gatgatttggggaagggtggccatgagcttagtctcagtactggaaatgctggtgggcga
cttgcatgcggtgttgttgggctgaccccgttgtag

DBGET integrated database retrieval system