KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347160
Entry
4347160           CDS       T01015                                 
Name
(RefSeq) probable ethanolamine kinase
  KO
K00894  ethanolamine kinase [EC:2.7.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4347160
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.82  ethanolamine kinase
     4347160
SSDB
Motif
Pfam: Choline_kinase APH DUF5887
Other DBs
NCBI-GeneID: 4347160
NCBI-ProteinID: XP_015651149
LinkDB
Position
9:16224919..16229345
AA seq 388 aa
MGSEGRSWSGAAAVGGGVEGEAAIAAVVAPAPGDVPASGASVDIALPLPEMTPRIIGICK
ELVRGWSSLDSSRFSIETVSGGITNMLLKVSAEDGKGNKSSVTVRLYGPNTDLVIDRKRE
LQAIPHLSAAGFGAQLLGTFENGMVQSFIYARTLTPSDMKEPRIAAEIAKEIRRFHQVDI
PGSKEPQLWDDIFKFMKKASILEFEDKEKQKRYETISFRKIQDEVKELKDLSDLLHAPVV
FSHNDLLSGNLMLNDLEEKLYFIDFEYGSYSYRGYDIANHFNEYAGYDCDYSLYPDKNSQ
YHFFRNYLQPDRPSEVQLQDLDALYVETNTYRLASHIYWALWALIQAKVSPIDFDYLGYF
FLRYDEYKKQRESCLSLAESSLSALKNG
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgggatcggaggggcggagctggagcggggcggcggcggtggggggcggcgtggaaggg
gaggcggcgatcgcggcggtggtggcgcctgcgccgggggacgtgccggcgtcgggcgcg
tccgtggacatagcgctgccgctcccggagatgacgccccgcatcataggtatctgcaag
gaattggtgagggggtggtcatcgctggacagctcgcgcttctcgatcgagacggtgtct
ggcggcatcacgaatatgttgctgaaggtgtccgcagaagatggcaagggtaacaagtct
tctgtgacagttcgtttgtatggcccaaatacagacttggtgattgatcggaagagggaa
ttgcaggctataccacatctctcagctgcagggtttggggctcagctacttggaacattt
gaaaatggaatggtccagtcattcatctatgcacgaacattaactccttcagacatgaag
gaacctagaatagcagctgagattgccaaagagattcgcagattccatcaagttgatata
ccaggatcaaaagaaccacagctatgggatgatatattcaagttcatgaaaaaagcttcg
atattggagtttgaggataaggagaagcagaagagatatgaaacaatctcttttagaaaa
atacaagatgaagttaaagaacttaaggatctgtcagaccttctgcatgctcctgtagtt
ttttcacacaatgacttgctttcaggcaatttgatgttgaatgatttggaagaaaagctc
tacttcattgatttcgagtatgggtcgtacagctaccgtggttatgatattgcaaaccat
ttcaatgaatatgcaggctatgattgcgactatagcttgtatccagataaaaattctcaa
taccacttcttcaggaactatcttcaacctgataggccaagtgaggtccaactgcaagat
ctggatgccctttatgtggaaacaaacacctatagattagcatcacacatttactgggcg
ttgtgggctcttattcaggcaaaggtatcccccattgatttcgactatcttggatacttt
tttctacggtacgacgaatacaagaaacagagggagtcatgcctctccttggcagaaagc
tccctctccgcattgaaaaatggctag

DBGET integrated database retrieval system