KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349694
Entry
4349694           CDS       T01015                                 
Name
(RefSeq) glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 isoform X1
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4349694
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4349694
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4349694
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     4349694
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4349694
SSDB
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4
Other DBs
NCBI-GeneID: 4349694
NCBI-ProteinID: XP_015617181
UniProt: A0A8J8XDE9 Q2RAY0
LinkDB
Position
11:complement(1554643..1559864)
AA seq 677 aa
MCGIFAYLNYNVSRERRYILEVLFNGLRRLEYRGYDSSGIAVDADVPSCASTSAVPPYAG
APPLVFRQEGKIENLVRSVYSEVDEKDVNLDAAFNVHAGIAHTRWATHGVPAPRNSHPQS
SGAGDEFLVVHNGIITNNEVLKETLIRHGFTFESDTDTEVIPKLAKFVFDKAHDEEGDVT
FSQVVMEVMRQLEGAYALIFKSPHYPNELIACKRGSTLILGVNELSGQNSGKPFHDVKAL
TTNGKPKELFFSSDLFAIVEHTKNYLAIEDDEIVHIKDGSVSILKFDHEKEKPASVQRAL
SVLEMEVEQIKKGSYDHFMQKEIHEQPHSLTTTMRGRVKDSGVLLGGLKEKEYLKTIRRS
RRLVFIGCGTSYNAALAARPFVEELTGIPVTMEVASDLLDRQGPIYREDTAFFVSQSGET
ADTLLALDYALENGALCVGITNTVGSTLSRRTHCGVHINAGCEIGVASTKAYTSQIVVMV
MVALAVGSDQISTQVRRQAIISGLSNLPSNVSEVFKLDTEMKELASSLIDSESLLVFGRG
YNYATALEGALKVKEVALMHSEGMLAGEMKHGPLALVDENLPIIVIATRDACFSKQQSVI
QQLLSRKGRLIVMCSKGDASAVCPSGSCRVIEVPEVADCLQPVINIIPLQLLAYHLTVLR
GFDVDQPRNLAKSVTTQ
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgtgcgggatcttcgcgtacctcaactacaatgtgtcgcgggagcgccggtacatcctc
gaggtcctcttcaatggcctccgccgcctcgagtaccgcggctacgactcctccggtatc
gccgtcgacgccgacgttccctcctgcgcttctacttctgcggtgccgccgtacgccggg
gcgcccccgctggtgttccgccaggagggcaagatcgagaacctcgtgcgatccgtctac
tccgaggttgatgagaaggatgtgaacctggacgccgccttcaatgtgcatgctggaatt
gcccacaccaggtgggccacgcacggtgtgcctgccccaaggaacagccacccccaatct
tctggtgctggcgatgaattcttggtcgtccacaatggcatcatcacaaacaacgaggtt
ctgaaagagacactaatccgacatgggttcacctttgagtctgatactgacacagaagtc
atccctaagttggcaaagtttgtttttgataaggcacatgatgaagaaggtgatgtgaca
tttagccaagttgttatggaagtcatgaggcagcttgaaggagcctacgcactcatcttt
aaaagcccacactaccccaatgaattgattgcatgcaaacggggcagcacactgatactc
ggtgtcaatgaattaagtggccaaaatagtgggaaaccatttcatgatgtcaaagctctg
acaacaaacgggaagccgaaagaattattcttctctagtgatttatttgctattgtggag
cataccaagaattatttggctatcgaagatgatgaaattgttcatattaaggacggcagt
gtgtcgatccttaagtttgaccatgagaaagagaagccagcttctgttcaacgagcattg
tctgtccttgagatggaagttgagcagataaagaaaggaagttatgaccacttcatgcaa
aaggaaatccatgaacagccacattcattaacaacaaccatgaggggtagagtgaaggat
agtggtgttcttttaggaggattaaaggaaaaggagtacctcaaaactattaggcgcagt
agaaggttagttttcattggctgtggtacaagttacaatgctgccttggctgcaagacct
tttgtggaggaattaactggtattcctgtgactatggaggttgcaagtgacttgctggac
agacaaggtcccatctacagggaagacactgcatttttcgttagccagtcaggggagaca
gcagataccctccttgctcttgattatgcactagaaaatggagcactttgtgttggcata
acaaataccgtaggaagcacactgtcaagaagaacacattgtggagttcatatcaatgct
ggttgtgagataggtgttgctagtacgaaggcatatacaagtcaaatagtagtcatggtg
atggtggccttggctgttggatctgatcaaatatccacccaagttagacgtcaagctatc
atcagtggtctttccaatcttccaagcaatgtcagcgaggttttcaaacttgatactgag
atgaaggaacttgcctcttccttgatcgattcagagtctctccttgtgtttggcagaggt
tataactatgccactgccttagagggtgctcttaaagttaaggaggttgctctgatgcac
agcgaaggcatgcttgctggtgaaatgaagcatggaccacttgcactagtggatgaaaac
cttccgatcatcgtcattgctacacgtgatgcgtgcttcagcaagcagcaatcagtgatt
cagcagctcctttctcgcaaggggcgtctgatagtgatgtgctcaaagggagacgcatct
gccgtttgccctagtggatcttgcagggttattgaagttccagaggtcgctgactgtctc
cagccagtgattaacataattccgttacagctgctcgcataccatctgacagttcttcga
ggatttgatgttgatcaaccaaggaatctggcaaagagtgtgactacccaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351413
Entry
4351413           CDS       T01015                                 
Name
(RefSeq) glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4351413
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4351413
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4351413
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     4351413
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4351413
SSDB
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4
Other DBs
NCBI-GeneID: 4351413
NCBI-ProteinID: XP_015620706
UniProt: A3CEN7
LinkDB
Position
12:complement(1500411..1505609)
AA seq 680 aa
MCGIFAYLNYNVSRERRYILEVLFNGLRRLEYRGYDSSGIAVDADVPSCASSSSSTAVPA
YAGASPLVFRQEGKIENLVRSVYSEVDEKDVNLDAAFNVHAGIAHTRWATHGVPAPRNSH
PQSSGAGDEFLVVHNGIITNYEVLKETLIRHGFTFESDTDTEVIPKLAKFVFDKAHDEEG
DVTFSQVVMEVMRQLEGAYALIFKSPHYPNELIACKRGSTLILGVNELSGQNSGKPFHDV
KALTTNGKPKELFFSSDLFAIVEHTKNYLAIEDDEIVHIKDGSVSILKFDHEKEKPASVQ
RALSVLEMEVEQIKKGSYDHFMQKEIHEQPHSLTTTMRGRVKDSGVLLGGLKEKEYLKTI
RRSRRLVFIGCGTSYNAALAARPFVEELTGIPVTMEVASDLLDRQGPIYREDTAVFVSQS
GETADTLLALDYALENGALCVGITNTVGSTLSRRTHCGVHINAGCEIGVASTKAYTSQIV
VMVMVALAVGSDQISTQVRRQAIISGLSNLPSNVSEVLKLDTEMKELSSSLIDSESLLVF
GRGYNYATALEGALKVKEVALMHSEGMLAGEMKHGPLALVDENLPIIVIATRDACFSKQQ
SVIQQLLSRKGRLIVMCSKGDASAVCPSGSCRVIEVPEVADCLQPVINIIPLQLLAYHLT
VLRGFDVDQPRNLAKSVTTQ
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgtgcgggatcttcgcgtacctcaactacaatgtgtcgcgggagcgccgctacatcctc
gaggtcctcttcaatggcctccgccgcctcgagtaccgcggctacgactcctccggcatc
gccgtcgacgccgacgttccctcctgcgcttcttcttcttcttctacggcggtgccggcc
tatgccggggcgtccccgctggtgttccgccaggagggcaagatcgagaacctcgtacga
tccgtctactccgaggttgatgagaaggatgtgaacctggacgccgccttcaatgtgcat
gctggaattgcccacaccaggtgggccacgcatggtgtgcctgccccaaggaacagccac
ccccaatcttctggtgccggcgatgagttcttggtcgtccacaatggcatcatcacaaac
tacgaggttctgaaagagacactaatccggcacgggttcacctttgagtctgatactgac
acagaagtcatccctaagttggcaaagtttgtttttgataaggcgcatgatgaagaaggt
gatgtgacatttagccaagttgttatggaagtcatgaggcagcttgaaggagcctacgca
cttatctttaaaagcccacactaccccaatgaattgattgcatgcaaacggggcagcaca
ctgatactcggtgtcaatgaattaagtggccaaaatagtgggaaaccatttcatgatgtc
aaagctctgacaacaaacgggaagcccaaagaattattcttctctagtgatttatttgct
attgtggagcataccaagaattatttggctatcgaagatgatgaaattgttcatattaag
gatggcagtgtgtctatccttaagtttgaccatgagaaagagaagccagcttctgtgcaa
cgagcattgtctgtccttgagatggaagttgagcagataaagaaaggaagttatgaccac
ttcatgcaaaaggaaatccatgaacagccacattcattaacaacaaccatgaggggtaga
gtgaaggatagtggtgttcttttaggaggattaaaggaaaaggagtacctcaaaactatt
aggcgcagtagaaggttagttttcattggctgtggtacaagttacaatgctgccttggct
gcaagaccttttgtggaggaattaactggtattcctgtgactatggaggttgcaagtgac
ttgctggacagacaaggtcccatctacagggaagacactgcagttttcgttagccagtca
ggggagacagcagataccctccttgctcttgattatgcactagaaaatggagcactttgt
gttggcataacaaataccgtaggaagcacactatcaagaagaacacattgtggagttcat
atcaatgctggttgtgagataggtgttgctagtaccaaggcatatacaagtcaaatagta
gtcatggtgatggtggccttggctgttggatctgatcaaatatccacccaagttagacgt
caagctatcatcagtggtctttccaatcttccaagcaatgtcagcgaggttttaaaactt
gataccgagatgaaggaactttcctcttccttgatcgattcagagtctctccttgtgttt
ggcagaggttataactatgccactgccttagagggtgctcttaaagttaaggaggttgct
ctgatgcacagcgaaggcatgcttgctggtgaaatgaagcatggaccacttgcactagtg
gatgaaaaccttccgatcatcgtcattgctacacgtgatgcgtgcttcagcaagcaacag
tcagtgattcagcagctcctttctcgcaaggggcgtctgatagtgatgtgctcaaaggga
gacgcatctgcagtttgccctagtggatcttgcagggttattgaagttccagaggtcgct
gactgtctccagccagtgattaacataattccgttacagctgctcgcataccatctgaca
gttcttcgaggatttgatgttgatcaaccaaggaatctggcaaagagtgtgactacccaa
tga

DBGET integrated database retrieval system