KEGG   Oceanicoccus sagamiensis: BST96_04245Help
Entry
BST96_04245       CDS       T04832                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:osg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BST96_04245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osg02000]
    BST96_04245
Enzymes [BR:osg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BST96_04245
Transporters [BR:osg02000]
 Other Transporters
  Pores ion channels [TC:1]
   BST96_04245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin GST_C_5 GST_N_4 VPS11_C
Motif
Other DBs
NCBI-ProteinID: ARN73389
UniProt: A0A1X9NCY5
LinkDB All DBs
Position
complement(941904..942572)
Genome map
AA seq 222 aa AA seqDB search
MAASIQLYSNDGCPYAQRTRIALLEKGLDFDFAEVDLANKPDWFVEASPSGKVPVLVHDG
HRLFESAIINEYIDEVWPQPALMPADAVLRAQARIWVDKFSAFASTLFYIGVKKDQQELQ
QLTEKLKAELQTIEDNGFAVFSGEGPYWFGQQLSLVDINFYTFFERMPMVEQKVGINLAA
YPLISRWYQAMSDRESVKATARTAEQHIESFNRLSDRLAARL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatcaatccaactctatagcaatgatggttgcccctatgcgcaacgtacccgc
attgctttgttggaaaaaggtttggactttgattttgccgaagtggatttagctaataag
ccagattggtttgttgaagcttctccctctggcaaagtgccggttttagtgcatgacgga
catcggctatttgaaagcgccattattaatgagtatatcgatgaggtatggccacagccg
gcgttaatgccagcagatgcagtgttaagggcgcaggccagaatctgggttgataaattt
tcagcttttgccagtacgctgttttatattggcgtgaaaaaagatcaacaagaattgcag
cagctaacagaaaaacttaaagccgaattgcaaactatagaagataacggttttgctgta
tttagtggtgagggcccttattggtttggtcagcagcttagcctggtggatattaacttt
tatacgttttttgaacgtatgcccatggtagagcaaaaggtcggtattaacttggccgct
tacccgttaatttcacgttggtatcaggccatgtctgatcgcgagagtgttaaagccacg
gcaagaacagcagagcaacatattgaaagctttaaccgcttatcagaccggttggcggca
cgactataa

DBGET integrated database retrieval system