KEGG   Oceanicoccus sagamiensis: BST96_08770Help
Entry
BST96_08770       CDS       T04832                                 

Definition
(GenBank) peptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00550  Peptidoglycan biosynthesis
osg01100  Metabolic pathways
osg01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:osg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BST96_08770
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BST96_08770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osg01003]
    BST96_08770
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:osg01011]
    BST96_08770
Enzymes [BR:osg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BST96_08770
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BST96_08770
Glycosyltransferases [BR:osg01003]
 Polysaccharide
  Bacterial polysaccharide
   BST96_08770
Peptidoglycan biosynthesis and degradation proteins [BR:osg01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BST96_08770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ARN74203
UniProt: A0A1X9NJP7
LinkDB All DBs
Position
complement(1903199..1905703)
Genome map
AA seq 834 aa AA seqDB search
MAHITNFTRIILWLLLSASTGALLILVSAYLYLSPKLPPVDVLKDVQLQTPLRIYSTDNQ
LIGEFGEKRRSPVTFNQIPTQFVQAILAAEDDRFFDHHGVDIKGLLRAASQLLVSGSIKT
GGSTITMQVAKNYFLSFEKTFSRKFNEILLALQIERELPKQEILELYVNKIFLGNRAYGI
EAAAQVYYGKSISELDLAQLAMIAGLPKAPSAYNPLVNPSRAIIRRNWILNRMLDLKYID
DNQHIEAISSPITATYHGSKVELYAPYIAEMVRKDMLKRYGRATYTDGFRVYTTINSELQ
ASATKAVISGLLAYDQRHGYRGPEQNLAVNDDSKASAEQDNSETTGEPDYTGWLNQLRKA
SRPGDLVPAVVIDVQEQSASALLASGDAIEIAWENGLKGKRPYVTVDRLGPNPKTASDVV
AIGDVIRVQRQADGQWLLTQLPAAQAALVSLDADNGAILSLVGGFNYSQSKFNRITQATR
QPGSNFKPFVYTAALANGFTPASTINDAPIVFEDASLESTWRPTNDGGKFYGPTRLRYAL
FKSRNLVSIRLLRSLGISKAINYVEKFGFDTSQLPRDLSLALGSHSLTPMEIVSGYSVLA
NGGYSVQPYLIQQIDDINGEALYKAMPNTVCRSCDDPAVKPVAEATEELATLEDILQQAD
SDPEPALPEAERVIEARVAYIIDSMMRDVVKKGTGRKARKLGRNDLAGKTGTTNGPTDAW
FSGYGGGIVTTAWFGFDKNGVLGNREYGGSAALPIWIDYMAVALKGRPEIAPKQPEGIVT
VKIDPTTGLLAKPGQSNAIFEIFREELAPTKEADSDDISGDTSQIEEVMEEDIF
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggctcatatcacaaatttcaccagaatcattttatggttattactatcggcatcgact
ggcgcattattaatattagtcagcgcctacctgtacctaagccctaaattgccccctgtc
gatgtactgaaagacgtgcaattgcagactcctttgcgtatttactccaccgacaaccaa
ctcattggcgaattcggcgaaaaacgcagaagcccagtcacctttaatcaaatccccact
caattcgtgcaagccatattagctgccgaagacgaccgtttcttcgaccatcatggcgta
gatatcaaaggcctgctgcgcgctgcctcacaattattggtaagcggctcaataaaaacc
ggcggcagcactatcactatgcaggtagccaaaaactattttctgagttttgaaaagact
ttttccaggaaattcaacgagatactgcttgccctgcaaattgagcgggagctgccaaag
caagaaatcctggagctatacgtcaataagatatttttgggaaatcgcgcttacggtatc
gaagcggcggcccaggtctattatggcaagtcaattagcgagctggatttggcccaactg
gccatgattgcaggcctgcctaaagcaccctccgcctataacccactggtcaacccctcc
cgggccattatccgccgtaactggatattaaaccggatgctggatttaaaatatattgat
gataaccagcatattgaagccattagcagccccattaccgccacctatcatggttctaaa
gtggagctatatgcgccgtatatcgccgaaatggtcagaaaagatatgcttaaacgctat
ggccgggccacctataccgatggcttcagagtttatacgacgatcaatagcgaactgcaa
gccagcgccaccaaagctgtgatcagcggcttactggcctatgatcagcggcacggctat
cggggaccagagcaaaatctggcagttaacgacgacagcaaagccagcgccgaacaagat
aacagtgaaaccaccggcgagcccgactataccggctggctaaaccaactccgcaaggcc
tcgagacccggtgatctggttcccgccgtggtgattgacgttcaggaacaatctgcctcg
gcactattagccagtggcgatgctattgagattgcatgggagaacggcctaaaaggcaag
cgcccctatgtcaccgttgatcgcttgggaccgaaccccaaaaccgccagtgatgtggtg
gccattggggatgtgattagagtgcagcggcaagcggatggccagtggctattaacgcaa
ttacccgcagcacaggcggctctggtttcgctggatgccgacaatggcgccatccttagc
cttgtcggcggctttaactatagccagagcaaatttaaccgtatcacccaggccacacga
cagcccggttccaactttaagccctttgtctataccgcagccctggctaacggctttacg
cccgccagcaccattaacgatgctcctatcgtgtttgaagatgccagccttgagagcacc
tggcggcccaccaatgatggtggcaaattctatggcccaacccgcctgcgctatgccctg
tttaagtcccgcaatttagtgtcgattcgattactcagaagcctcggtatttccaaagcg
atcaactatgttgagaaatttggctttgataccagccaactaccccgagacctttccctg
gctttgggcagccactcattaacccctatggagatagtaagtggttactccgtactggct
aatggcggctatagcgtccagccctatttaattcaacagatcgacgatatcaatggcgaa
gcgctctataaagcgatgcccaataccgtctgccgtagctgtgatgaccccgctgtgaaa
cctgtggctgaagctaccgaagagctggcaaccctcgaagatattctgcaacaggctgac
tctgatccagagcctgcactgccagaagctgagcgggtgatcgaagccagagtcgcttat
attatcgatagcatgatgcgcgacgtggtgaaaaagggcaccggccgcaaagccagaaag
ctgggccgcaatgatctggcgggtaaaaccggcaccaccaatggcccaaccgatgcctgg
ttctctggctatggtggcggcattgtcaccaccgcctggtttggctttgataaaaatggc
gtgctgggtaatcgggaatatggcggctctgcggccttgccgatctggattgactatatg
gctgtcgccctaaaaggccgccccgaaatagcccccaagcaaccggaaggcattgtgacc
gtaaaaattgacccaaccaccggcctgttggctaaaccggggcaatccaatgcgatcttt
gaaatcttccgggaagaactagcgccgaccaaggaagcggatagcgatgatatctccgga
gataccagccaaattgaagaggtaatggaagaggatattttttaa

DBGET integrated database retrieval system