KEGG   Oceanicoccus sagamiensis: BST96_15540Help
Entry
BST96_15540       CDS       T04832                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00020  Citrate cycle (TCA cycle)
osg00270  Cysteine and methionine metabolism
osg00620  Pyruvate metabolism
osg00630  Glyoxylate and dicarboxylate metabolism
osg00680  Methane metabolism
osg01100  Metabolic pathways
osg01110  Biosynthesis of secondary metabolites
osg01120  Microbial metabolism in diverse environments
osg01130  Biosynthesis of antibiotics
osg01200  Carbon metabolism
Module
osg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osg_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BST96_15540
   00620 Pyruvate metabolism
    BST96_15540
   00630 Glyoxylate and dicarboxylate metabolism
    BST96_15540
  09102 Energy metabolism
   00680 Methane metabolism
    BST96_15540
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BST96_15540
Enzymes [BR:osg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BST96_15540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ARN75399
UniProt: A0A1X9NIT7
LinkDB All DBs
Position
complement(3381586..3382566)
Genome map
AA seq 326 aa AA seqDB search
MKQPVRVTVTGAAGQIGYALLFRIASGAMLGEDQPVILQLLDITPAMDALEGVKMELDDC
AFPLLAGVVCTDDPDVGFKDSDYALLVGARPRGPGMERKDLLEANAAIFSVQGKAIDQNA
SKDIKVLVVGNPANTNALITQRNAPSIPKENFTAMMRLDHNRAKSQLATKTGKAVTDVKN
MIVWGNHSATQYPDLSNTTVAGTPALDLVEQDWYENDYIPTVAQRGAAIIKARGASSAAS
AANAAIDHVRSWALGTTDGDYVSMGVYSDGSYGIEEGLIYSFPCTCENGEWTIVQGLSVS
EFSQGRMKATEAELTEERDGVAHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacccgtacgcgttaccgttactggtgcagctggccaaattggctatgcactt
cttttccgcattgcttctggcgccatgttaggcgaagaccagcctgtaatcctgcaatta
ctggatatcacccctgcaatggacgcccttgaaggcgttaagatggaattggacgattgt
gccttccctctattggccggtgttgtttgcactgacgaccctgatgttggctttaaagac
agcgactatgccctattggttggtgcacgtcctcgtggcccaggtatggagcgtaaagac
ttgctagaagccaacgctgctatcttctctgttcagggtaaagccattgaccagaatgcc
agcaaagacatcaaagtattggttgtaggcaaccctgccaacactaacgctctgattact
cagcgcaatgcaccgagcattcctaaagagaacttcactgccatgatgcgtttggaccac
aaccgcgccaagtcgcaattagcgactaaaacgggcaaggctgttaccgacgttaaaaac
atgatcgtttggggcaaccactcagcgactcagtaccctgatctttcaaacaccacagtt
gcgggtacccctgctctggatctggttgagcaagactggtacgaaaacgactatatccca
actgttgcacaacgtggcgcggctatcattaaagcccgtggcgcttcttctgccgcttct
gctgctaacgccgctatcgaccacgttcgcagctgggcgctgggcacgacggatggcgac
tatgtgtctatgggggtttactcagatggctcttacggtattgaagaaggtttgatctac
tcatttccttgtacttgtgagaatggcgagtggacgattgttcaaggcttgtcagttagc
gaattcagccagggcagaatgaaagccactgaagctgaactcactgaagagcgtgatggc
gtggcgcacttgctaccttaa

DBGET integrated database retrieval system