KEGG   Oceanicoccus sagamiensis: BST96_19125Help
Entry
BST96_19125       CDS       T04832                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00071  Fatty acid degradation
osg00280  Valine, leucine and isoleucine degradation
osg00281  Geraniol degradation
osg00310  Lysine degradation
osg00362  Benzoate degradation
osg00380  Tryptophan metabolism
osg00410  beta-Alanine metabolism
osg00640  Propanoate metabolism
osg00650  Butanoate metabolism
osg00903  Limonene and pinene degradation
osg00930  Caprolactam degradation
osg01100  Metabolic pathways
osg01110  Biosynthesis of secondary metabolites
osg01120  Microbial metabolism in diverse environments
osg01130  Biosynthesis of antibiotics
osg01200  Carbon metabolism
osg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BST96_19125
   00650 Butanoate metabolism
    BST96_19125
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BST96_19125
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BST96_19125
   00310 Lysine degradation
    BST96_19125
   00380 Tryptophan metabolism
    BST96_19125
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BST96_19125
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BST96_19125
   00281 Geraniol degradation
    BST96_19125
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BST96_19125
   00930 Caprolactam degradation
    BST96_19125
Enzymes [BR:osg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BST96_19125
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BST96_19125
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BST96_19125
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     BST96_19125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ARN76020
UniProt: A0A1X9NDB1
LinkDB All DBs
Position
4213770..4215914
Genome map
AA seq 714 aa AA seqDB search
MNFKGKAISVDVNDNIATLTFDLQGESVNKFNRLTLGELKEVGQLLTQAKDIKGLLVRSN
KDSFIVGADITEFGDMFHLPEEEMLAGINAINADFSVFEDLPFPTVTAINGLALGGGLEM
ALTTDFRVMDSHAKIGFPEVKLGIIPGYGGTVRAPRIIGTDNAVEWIATGKDNKAKAALA
AGMVDAVVEADQLDAAAMDLLQKAINGDFDIAAIRKQKTSPLQLDDIENIMAFTTAKALI
GQQAGRHYKAPMYAVKTIEKAAKLGRDEAIKVENEAVTKLGKMEITGNMINLFLGDQALT
KTAKGYASNNTPVERAAVLGAGIMGGGIAYQSASTGTPIIMKDIAQAGIDMGMGEAAKLL
STKVKRGRLTADKMAATLNKITPTLSYDGIDQADLIVEAVVENPAVKKAVLAEVEGLISD
DTILTSNTSTIPITELASALKRPENFCGMHFFNPVHKMPLVEIIRGEKTSDAAIARTVNY
ALAMKKKPVVVNDCPGFLVNRILFAYFAGFVALVKEGADFVAIDKAAEKFGWPMGPAYLC
DVVGIDTGVHAGKVMSDGFPDRMGQTFKTCLEVMLENDRLGEKNSQGFYDYKADKRGKLR
KTYNESVKALLAPHVDAPKEFSEEEIMDRLMVPFCLESIRCLEADIVSSATDLDMALIFG
VGFPPFKGGAIRFVENMGLAAFVEKADQYKELGPLYHPTDTLRDLAANNGSMFK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaaaggtaaagctatcagcgtcgatgttaacgataatatcgccacgctaaca
ttcgacttacaaggtgagtcagtcaataaatttaaccgactaaccctcggcgaattgaaa
gaggtaggccagctgcttacccaggccaaagatattaaaggcctgttagttcgcagcaat
aaagatagctttattgtcggtgcagatatcactgaattcggtgatatgtttcatttgcca
gaagaagagatgttggccggcattaatgccatcaacgccgatttttctgtgtttgaagac
ctgcccttccctaccgtcaccgccattaatggcctggcactgggcggcggtttggaaatg
gcactgacgaccgattttcgagtaatggatagccatgcgaaaattggcttccctgaagtc
aaactgggcattatccccggctacggcggcaccgttcgtgcaccacgtattattggcacc
gacaatgctgttgagtggattgctaccggcaaagacaacaaagccaaggccgcattagcc
gccggtatggtcgatgctgtggtagaagccgatcaacttgatgccgcggcaatggacctg
ttacaaaaagcgattaatggcgattttgatattgccgccatccgtaaacagaaaacctca
ccactgcaattagatgatattgaaaatatcatggcctttaccaccgccaaagcgctaatt
ggccagcaagcaggtcgccactataaagcacccatgtatgcggtaaaaacgattgagaaa
gccgccaagctaggccgtgatgaggccatcaaggttgagaacgaagcagtcaccaaactc
ggtaaaatggaaatcaccggtaatatgatcaacctgttcctcggtgatcaggccctgacc
aaaacggccaaaggctatgcctccaataacacaccggtagaacgcgctgcggtactaggc
gccggtattatgggtggcggtattgcttaccagtccgcctcgaccggcacccctattatc
atgaaagatatcgcccaggccggtattgatatggggatgggagaagctgccaaactatta
tccactaaagttaagcgtgggcgtttaaccgcggataaaatggccgccaccctcaacaag
attacaccaacactaagctatgacggtattgaccaggccgacctgattgtagaagccgtg
gttgaaaaccctgccgttaaaaaagccgtattagccgaagtagaaggtttgattagtgac
gacaccatcctgacctctaacacgtcaaccatccccattaccgagttagcctcggcgcta
aaacgcccggaaaacttctgtggtatgcacttctttaacccggtgcataaaatgccactg
gttgaaattatccgcggcgaaaaaaccagtgatgctgctatcgccagaacggttaactat
gcactggccatgaagaaaaagccggtggttgttaatgactgcccggggtttttggttaac
cgtattttatttgcctacttcgccggctttgttgcactggttaaagaaggcgctgacttt
gtggctatcgataaagctgctgagaaatttggctggccgatgggccccgcctacctgtgt
gatgtggtcggtattgatactggcgttcatgctggcaaggttatgtctgatggattccct
gatcgcatgggtcaaacctttaaaacctgtttagaagtgatgctggaaaatgatcgtctt
ggtgagaaaaacagccagggcttttacgactataaagcggacaaacgtggcaagctacgc
aaaacttataatgagtcggttaaagcattactggcacctcatgttgatgcgccaaaagaa
tttagcgaagaagagattatggaccgcctaatggtgccattctgtcttgaatctattcgc
tgtctggaagcggacattgttagcagtgccactgatttggatatggcgcttatctttggt
gtaggcttcccaccctttaaaggtggcgctatccgctttgttgaaaatatgggtctggct
gccttcgttgaaaaagccgatcagtataaggaactggggcctctctaccaccctactgac
acactacgggacttagcagccaataacggcagcatgtttaagtaa

DBGET integrated database retrieval system