KEGG   Odoribacter splanchnicus: Odosp_0123
Entry
Odosp_0123        CDS       T01428                                 

Definition
(GenBank) Diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00300  Lysine biosynthesis
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01120  Microbial metabolism in diverse environments
osp01230  Biosynthesis of amino acids
Module
osp_M00526  Lysine biosynthesis, DAP dehydrogenase pathway, aspartate => lysine
osp_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:osp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Odosp_0123
Enzymes [BR:osp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Odosp_0123
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Other DBs
NCBI-ProteinID: ADY31235
UniProt: F9Z2V5
LinkDB
Position
140678..141916
AA seq 412 aa
MYTFEQCKKLELEIGTPAYLVNEDLFLNNLRDIRAAFKSLYQNIVVGYSFKTNYLPYLCK
LALEQGCYAEVVSFLEYQIALKVGFTGNQIIFNGPIKRESEFVTALLNGSVINIDSDYEI
DYLERLKEIYPENQFEIGLRVNVSIKDENGCSAIYGEEESGRFGFMEDEIDKAIERLTKI
NCKIISLHGHTSSKNRAINNYVQIIDKLFEIQHHYKLDIKYINIGGGFFGPVPPGMFGYA
TPSYKDYAEVIIAKLHTNRWFCENRPCLVIEPGMSVAASSMAYITKVFDVKKRSNRWIAQ
VDGNMFHIRPSMHTMKIPFQIISGRVIDNVETKRIDFAGSTCMESDVLVRTETCRQVHQG
DFLEIDNVGGYTFVMGANFIQFLPHIAILKNNEFISLREGSNFDNFIEIFNW
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgtatacatttgaacaatgtaagaaactggaactggaaatagggactccggcttatttg
gttaatgaagatttatttttgaataatctgagagatattcgggctgcttttaaatcacta
tatcagaatattgtagtcggatattcatttaagactaattatttaccgtatctgtgcaag
ttagctctggagcaggggtgttatgcagaggtggtttcttttttggaatatcagatagct
ttgaaagtaggttttaccgggaatcagattatttttaacggaccaattaaacgggaaagt
gaatttgttactgcacttttaaatggatctgttattaatattgatagtgattatgaaata
gattatttggaacgtttgaaagaaatatatcctgaaaatcagtttgaaatagggttacgt
gtcaatgtttccattaaggatgaaaatggttgttctgcaatttacggagaggaggaaagt
ggtcgttttggttttatggaggatgaaatagataaggctatagagcgtttgacaaaaatt
aattgtaaaataatttcattacatggccatacttcatccaagaatagggcaataaataat
tatgtccagatcattgataagttatttgaaatacagcatcattataaattagatattaaa
tacatcaatattggaggcggattttttggaccagtacctcccggtatgtttggttatgca
acaccttcttataaggattatgcagaagtaataattgcaaagcttcatacaaaccgttgg
ttttgtgaaaataggccctgtttggtaatagagccgggaatgtctgtggctgcttcttca
atggcttatataacaaaagtctttgatgtaaagaaacggagtaaccgttggattgcacag
gttgacggtaatatgtttcatatccgtccatccatgcatacaatgaaaataccatttcaa
ataatcagcggacgtgttattgacaatgttgaaacgaagagaattgattttgcaggttct
acctgtatggaatctgatgttctggtaagaacagaaacttgtcgtcaagttcatcaggga
gattttttggaaatagataacgttggaggctacacttttgtaatgggggcaaattttata
caattcttacctcatatagcaattctaaaaaataatgaattcatttctctcagagaggga
agcaattttgataatttcattgaaatttttaactggtga

DBGET integrated database retrieval system