KEGG   Odoribacter splanchnicus: Odosp_2765Help
Entry
Odosp_2765        CDS       T01428                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
osp  Odoribacter splanchnicus
Brite
KEGG Orthology (KO) [BR:osp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Odosp_2765
Enzymes [BR:osp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Odosp_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA Thi4 Thioredoxin_3 FAD_oxidored DAO AlaDh_PNT_C NAD_binding_7 NAD_binding_8 FAD_binding_3 Thioredoxin_4 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADY33743
UniProt: F9Z4Q8
LinkDB All DBs
Position
complement(3293634..3295187)
Genome map
AA seq 517 aa AA seqDB search
MLETALKDQLRTIFAPLDSRYTFLIRLNPRHENRNELIELLEDVASCSEKINYRLEEGEG
LEFELLKNEQKTRIKFRGIPNGHEFTSLLLAILNSDGKGKNIPDGNLQKRIAALKGPIRL
TTYVSLTCTNCPDVVQALNLMAILNDNIEHEMVDGAINQAEVEALHIQGVPSVYADGKLI
HIGRGEFGELLEKLEATYGSENTGQEIPEKKYDVLIVGGGPAGSSAAIYSARKGLKVAII
AERIGGQVKETVGIENLISIPYTTGSQLADNLRTHLQHYPIDLFEHRKVEKMEHTGKEKI
LSVTGGEKFVAPAIIIATGASWRRLNVPGETDYIGKGVAFCPHCDGPFYKGKHVAVIGGG
NSGIEAAIDLAGICSKVTVFEFLEELKADQVLQEKAKSLPNVEILVNSQTTEVVGDKEKV
TGIRTKDRTTGNERLFPLDGIFVQIGLAANSSAFKEIVATNRLEEIIIDAHCRTDIPGIY
AAGDVSTVPYKQIIISMGEGAKAALSAFEDRIKGVLD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaacagcattaaaagaccagttacgcaccatttttgcaccgctggattcccga
tacacttttttaatccggcttaatccccgacacgaaaaccggaatgaattgatcgaacta
ttagaggatgtcgcctcttgttcagaaaaaatcaattaccggctggaagaaggagagggg
ctggaatttgaattgctgaaaaatgaacaaaaaacgaggatcaaattccggggcataccg
aacggtcacgaattcacttctttactattggccatcctcaacagcgacggcaaagggaaa
aacatacccgacgggaacttacagaaacgtatagcagccttgaagggaccgatccggtta
actacctatgtatccttaacatgtacgaattgtccggatgttgtacaggccttgaatctg
atggctatcctgaacgacaacatagaacacgaaatggtagacggagcgataaatcaagcc
gaagtagaggctctgcatatacagggagtgccttcggtatatgccgacggtaagctcata
cacatcggacggggagaattcggagaactccttgaaaaattggaggcgacctacggttcg
gagaataccggccaggaaatcccggaaaagaaatacgacgtcctgatcgtaggaggtggt
ccggcaggctcttcggcagccatctactcggccagaaaaggactgaaagtagccatcatt
gccgagcgtatcggaggccaggtgaaagaaaccgtgggtatcgaaaatctgatttctatt
ccttacacgacaggtagtcagcttgccgataatctgcgtacccatcttcaacattatccg
atcgatctgttcgaacatcggaaagtggaaaaaatggagcataccggaaaagaaaaaatt
ctttcggtaaccggaggagaaaaatttgtcgccccggctatcattatcgctaccggagct
agttggcggcgtttgaatgtacctggcgaaacagactatatcggtaaaggagtagctttt
tgcccccactgtgatggtcctttttataaaggaaaacacgtggctgtcatcggaggaggt
aattcaggaatcgaagcagcgatcgatttggcgggaatttgttctaaagtaactgttttt
gaattcctggaagagttaaaagccgatcaggtattacaggaaaaagcgaaaagtctgcct
aatgtagaaattctggtcaactcccaaacaaccgaagtggtgggagacaaagaaaaagtg
acaggcattcgcacaaaagacaggacaacgggtaatgaacgcttgttccccctggacggt
attttcgtacaaatcggactagcagccaatagcagtgcttttaaagaaattgtcgcgacc
aatcgtctggaagaaatcatcatcgatgcccattgccggaccgacattccgggtatctat
gcagccggcgatgtttccaccgtcccctataaacaaattattatctcaatgggagaagga
gccaaagcagcactctcagctttcgaagaccgtattaaaggggtattggattaa

DBGET integrated database retrieval system